Sequences
EST Library Info
cbl3Blood
Clusters
Oligos
SNPs

Gene ID ENSG00000121895 (click for geneview)
Transcript ID ENST00000241302(link to ensembl)
Symbol NP_079219.1
Localtion Chromosome:4:38790935:38856548:-1 band: 4p14
Description hypothetical protein FLJ23235
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------------------------><-----------
-M--T--K--T--A--L--L--K--L--F--V--A--I--V--I--T--F--I--L--I--L--P--E--Y--F--K--T--P--K--E--R--T--L--
ATGACAAAAACAGCCCTCCTTAAATTATTTGTGGCAATAGTGATCACATTCATTTTAATTTTGCCGGAATATTTCAAGACACCGAAAGAAAGAACATTGG
:::::::::::::::::::::::::::.:: :::::::::::::::..:::::::::::::::::.:::::::::::::::::.:.:         ::::
ATGACAAAAACAGCCCTCCTTAAATTACTTTTGGCAATAGTGATCATGTTCATTTTAATTTTGCCAGAATATTTCAAGACACCAAGA---------TTGG
-M--T--K--T--A--L--L--K--L--L--L--A--I--V--I--M--F--I--L--I--L--P--E--Y--F--K--T--P--R-----------L--

----------------------------------------------------------------------------------------------------
E--L--S--C--L--E--V--C--L--Q--S--N--F--T--Y--S--L--S--S--L--N--F--S--F--V--T--F--L--Q--P--V--R--E--T
AGCTATCATGTCTGGAAGTGTGTTTGCAATCTAATTTTACCTATTCACTCTCCTCCTTAAATTTTTCTTTTGTGACTTTTCTGCAACCAGTAAGGGAAAC
::::::::::.::.:::::::::::.:::.:::::::::::.:::::.::::.: .:::::::::::::::::::::::::::::::::.::::.:::::
AGCTATCATGCCTAGAAGTGTGTTTACAACCTAATTTTACCCATTCATTCTCTTATTTAAATTTTTCTTTTGTGACTTTTCTGCAACCAATAAGAGAAAC
E--L--S--C--L--E--V--C--L--Q--P--N--F--T--H--S--F--S--Y--L--N--F--S--F--V--T--F--L--Q--P--I--R--E--T

----------------------------------------------------------------------------------------------------
--Q--I--I--M--R--I--F--L--N--P--S--N--F--R--N--F--T--R--T--C--Q--D--I--T--G--E--F--K--M--C--S--S--C-
TCAGATTATCATGAGAATCTTTCTAAATCCCTCCAATTTTCGTAACTTCACCAGGACTTGCCAAGACATCACAGGTGAATTTAAAATGTGCTCCTCGTGT
:::::.:.:.:::.::::::::::::::: :::::..::::. :::.::::..:::.:::::::::::::::: :::::::::::::::::::.::.:::
TCAGACTGTTATGGGAATCTTTCTAAATCACTCCAGCTTTCAAAACCTCACTGGGATTTGCCAAGACATCACACGTGAATTTAAAATGTGCTCTTCATGT
--Q--T--V--M--G--I--F--L--N--H--S--S--F--Q--N--L--T--G--I--C--Q--D--I--T--R--E--F--K--M--C--S--S--C-

---------------------------------------------------------><-----------------------------------------
-L--V--C--E--S--K--G--N--M--D--F--I--S--Q--E--Q--T--S--K--V--L--I--R--R--G--S--M--E--V--K--A--N--D--
TTGGTTTGTGAGTCTAAAGGAAACATGGATTTTATTTCTCAGGAACAAACATCAAAAGTTCTTATCAGGAGAGGATCAATGGAAGTGAAAGCAAATGATT
::::.:::::::::.::::::::::::::::::::::::::::::::::::::::::   ::::::: ::::::::::.::::..::::..::.::::::
TTGGCTTGTGAGTCCAAAGGAAACATGGATTTTATTTCTCAGGAACAAACATCAAAA---CTTATCATGAGAGGATCAGTGGAGATGAAGACAGATGATT
-L--A--C--E--S--K--G--N--M--D--F--I--S--Q--E--Q--T--S--K-----L--I--M--R--G--S--V--E--M--K--T--D--D--

----------------------------------------------------------------------------------------------------
F--H--S--P--C--Q--H--F--N--F--S--V--A--P--L--V--D--H--L--E--E--Y--N--T--T--C--H--L--K--N--H--T--G--R
TTCATTCACCTTGTCAGCACTTTAACTTCAGTGTAGCTCCTCTGGTTGACCACTTGGAGGAATATAACACTACCTGTCATCTAAAAAACCACACTGGAAG
:::::::: :::::::.::.:::::::::: :::::::::: ::::::::::::::::::::::.::.:.:::::.: : ::::::: :::: ::.::::
TTCATTCAGCTTGTCAACATTTTAACTTCACTGTAGCTCCTATGGTTGACCACTTGGAGGAATACAATATTACCTATAAACTAAAAACCCACCCTAGAAG
F--H--S--A--C--Q--H--F--N--F--T--V--A--P--M--V--D--H--L--E--E--Y--N--I--T--Y--K--L--K--T--H--P--R--R

----------------------------------------------------------------------------------------------------
--S--T--I--M--E--D--E--P--S--K--E--K--S--I--N--Y--T--C--R--I--M--E--Y--P--N--D--C--I--H--I--S--L--H-
ATCAACAATCATGGAGGATGAGCCAAGCAAGGAGAAATCGATAAACTACACTTGTAGAATCATGGAATACCCGAATGATTGTATACACATTTCTTTGCAC
.:::::::::: .::::: :: :::: ::::::.  :::  ::::..:.::.::::::::.:::::: ::..::::.:::::::: ::::::::::::::
GTCAACAATCAAAGAGGAAGATCCAACCAAGGAACCATCTCTAAATCATACCTGTAGAATTATGGAAAACTTGAATAATTGTATAAACATTTCTTTGCAC
--S--T--I--K--E--E--D--P--T--K--E--P--S--L--N--H--T--C--R--I--M--E--N--L--N--N--C--I--N--I--S--L--H-

------------------><--------------------------------------------------------------------------------
-L--E--M--D--I--K--N--I--T--C--S--M--K--I--T--W--Y--I--L--V--L--L--V--F--I--F--L--I--I--L--T--I--R--
CTAGAGATGGATATAAAAAATATCACTTGTTCCATGAAGATCACTTGGTATATTTTAGTTCTATTAGTTTTTATATTTTTGATCATCCTCACTATCCGCA
:::::.::::::.::.::   .:...::::::::::::::::::::::::.::..:::   :::::::::::::::::::. :::::::::.::::::::
CTAGAAATGGATGTAGAA---GTTGTTTGTTCCATGAAGATCACTTGGTACATCCTAGGGGTATTAGTTTTTATATTTTTACTCATCCTCATTATCCGCA
-L--E--M--D--V--E-----V--V--C--S--M--K--I--T--W--Y--I--L--G--V--L--V--F--I--F--L--L--I--L--I--I--R--

--------------------------------------><------------------------------------------------------------
K--I--L--E--G--Q--R--R--V--Q--K--W--Q--S--H--R--D--K--P--T--S--V--L--L--R--G--S--D--S--E--K--L--R--A
AAATACTTGAAGGCCAGAGAAGAGTGCAAAAGTGGCAGAGTCATAGAGACAAACCTACATCTGTTCTCTTAAGAGGAAGTGATTCGGAGAAACTGAGAGC
:::::::::::::::: ::.::::::::.:::::::::   ::::.: :::::::::::::: : ::.::::::::::::::::: ::::::::: ::.:
AAATACTTGAAGGCCACAGGAGAGTGCAGAAGTGGCAG---CATAAATACAAACCTACATCTCTACTTTTAAGAGGAAGTGATTCTGAGAAACTGCGAAC
K--I--L--E--G--H--R--R--V--Q--K--W--Q-----H--K--Y--K--P--T--S--L--L--L--R--G--S--D--S--E--K--L--R--T

----------------------><------------------------------------------------------------------>
--L--N--V--Q--V--L--S--A--E--T--T--Q--R--L--P--L--D--Q--V--Q--E--V--L--P--P--I--P--E--L--*-
ATTGAATGTGCAGGTTCTTTCAGCAGAGACCACGCAGAGGCTGCCTTTGGATCAAGTCCAGGAAGTGCTTCCCCCAATTCCAGAACTATAA
:::::::::::::::: :::::   ::::::::: ::::::::::::::: :::.::: :::: ::::::::.::::: :::::.:::   
ATTGAATGTGCAGGTTATTTCA---GAGACCACGAAGAGGCTGCCTTTGGCTCAGGTCAAGGATGTGCTTCCTCCAATACCAGAGCTA---
--L--N--V--Q--V--I--S-----E--T--T--K--R--L--P--L--A--Q--V--K--D--V--L--P--P--I--P--E--L----

Pig Consensus Sequence

>BGISUST0000885704
ATGACAAAAACAGCCCTCCTTAAATTACTTTTGGCAATAGTGATCATGTTCATTTTAATTTTGCCAGAATATTTCAAGACACCAAGA---------TTGG
AGCTATCATGCCTAGAAGTGTGTTTACAACCTAATTTTACCCATTCATTCTCTTATTTAAATTTTTCTTTTGTGACTTTTCTGCAACCAATAAGAGAAAC
TCAGACTGTTATGGGAATCTTTCTAAATCACTCCAGCTTTCAAAACCTCACTGGGATTTGCCAAGACATCACACGTGAATTTAAAATGTGCTCTTCATGT
TTGGCTTGTGAGTCCAAAGGAAACATGGATTTTATTTCTCAGGAACAAACATCAAAA---CTTATCATGAGAGGATCAGTGGAGATGAAGACAGATGATT
TTCATTCAGCTTGTCAACATTTTAACTTCACTGTAGCTCCTATGGTTGACCACTTGGAGGAATACAATATTACCTATAAACTAAAAACCCACCCTAGAAG
GTCAACAATCAAAGAGGAAGATCCAACCAAGGAACCATCTCTAAATCATACCTGTAGAATTATGGAAAACTTGAATAATTGTATAAACATTTCTTTGCAC
CTAGAAATGGATGTAGAA---GTTGTTTGTTCCATGAAGATCACTTGGTACATCCTAGGGGTATTAGTTTTTATATTTTTACTCATCCTCATTATCCGCA
AAATACTTGAAGGCCACAGGAGAGTGCAGAAGTGGCAG---CATAAATACAAACCTACATCTCTACTTTTAAGAGGAAGTGATTCTGAGAAACTGCGAAC
ATTGAATGTGCAGGTTATTTCA---GAGACCACGAAGAGGCTGCCTTTGGCTCAGGTCAAGGATGTGCTTCCTCCAATACCAGAGCTA---


>BGISUSP0000885704
MTKTALLKLLLAIVIMFILILPEYFKTPR---LELSCLEVCLQPNFTHSFSYLNFSFVTFLQPIRETQTVMGIFLNHSSFQNLTGICQDITREFKMCSSC
LACESKGNMDFISQEQTSK-LIMRGSVEMKTDDFHSACQHFNFTVAPMVDHLEEYNITYKLKTHPRRSTIKEEDPTKEPSLNHTCRIMENLNNCINISLH
LEMDVE-VVCSMKITWYILGVLVFIFLLILIIRKILEGHRRVQKWQ-HKYKPTSLLLRGSDSEKLRTLNVQVIS-ETTKRLPLAQVKDVLPPIPEL-