Sequences
EST Library Info
plac2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000137156 (click for geneview)
Transcript ID ENST00000244360(link to ensembl)
Symbol RNF39
Localtion Chromosome:6:30146023:30151607:-1 band: 6p21.33
Description RING finger protein 39 (Protein HZFw). [Source:Uniprot/SWISSPROT;Acc:Q9H2S5]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--W--W--R--D--L--T--R--L--R--L--W--L--K--R--E--A--I--P--G--E--G-----R--K--A--A--K--V--N--A--G--V--
ATGTGGTGGAGAGATTTGACGAGACTGAGACTCTGGTTGAAGAGAGAGGCAATCCCAGGAGAGGGG---CGGAAAGCGGCAAAAGTTAATGCGGGAGTCG
                                 :::::::::::::::::.::::::::::::::     :.:::    :.:::::::::::::::: ::
---------------------------------TGGTTGAAGAGAGAGGCGATCCCAGGAGAGGGCC--AGAAAACGTCCGAAAGTTAATGCGGGAGGCG
----------------------------------W--L--K--R--E--A--I--P--G--E--G--\--R--K--R--P--K--V--N--A--G--G--

----------------------------------------------------------------------------------------------------
G--E--K--G--I--Y--T--A--S--S--R--G--G--P--P--S--A--R--S--K--A--V--T--V--V--A--E--G--A--A--S--R--S--W
GAGAGAAGGGCATCTACACAGCAAGCAGCAGGGGCGGCCCGCCATCTGCGCGCTCGAAGGCGGTCACGGTGGTCGCGGAAGGGGCGGCGTCCAGATCCTG
::::::.::::::: ::.::.: ::::::::.:::: .: :::: ::::::::::::::::: ::.: : :::::::::::::.:::::.:::::. :::
GAGAGAGGGGCATCAACGCAACCAGCAGCAGAGGCGCTCAGCCAGCTGCGCGCTCGAAGGCGTTCGCTGGGGTCGCGGAAGGGACGGCGCCCAGACGCTG
G--E--R--G--I--N--A--T--S--S--R--G--A--Q--P--A--A--R--S--K--A--F--A--G--V--A--E--G--T--A--P--R--R--W

----------------------------------------------------------------------------------------------------
--L--S--M--D--A--P--E--L-----G--P--G--L--V--E--R--L--E--Q--L--A--T--C--P--L--C--G--G--S--F--E--D--P-
GCTTTCCATGGATGCGCCCGAGCTG---GGCCCGGGGCTGGTGGAGCGTCTGGAGCAGCTGGCGACGTGTCCTCTGTGCGGGGGCTCCTTCGAGGACCCG
:::..:::::.: ::::: :::::.   ::::::::::::::::::::::::::::::.::::::::::.:: ::::::::::::.::::::::::::::
GCTCCCCATGAAGGCGCCGGAGCTACTGGGCCCGGGGCTGGTGGAGCGTCTGGAGCAGTTGGCGACGTGCCCGCTGTGCGGGGGCCCCTTCGAGGACCCG
--L--P--M--K--A--P--E--L--L--G--P--G--L--V--E--R--L--E--Q--L--A--T--C--P--L--C--G--G--P--F--E--D--P-

----------------------------------------------------------------------------------------------------
-V--L--L--A--C--E--H--S--F--C--R--A--C--L--A--R--R--W--G--T--P--P--A--T--G--T--E--A--S--P--T--A--C--
GTGCTTCTGGCGTGCGAGCACAGCTTCTGCCGCGCGTGTCTGGCCCGCCGCTGGGGGACTCCGCCGGCGACCGGCACCGAGGCTTCCCCCACCGCCTGTC
:::::.::::::::.:::::::::::::::::::::::.:::::::::.::::::::::.::::::::::: ::: :::::.: .:::::::::::::.:
GTGCTCCTGGCGTGTGAGCACAGCTTCTGCCGCGCGTGCCTGGCCCGCTGCTGGGGGACCCCGCCGGCGACGGGCCCCGAGACGCCCCCCACCGCCTGCC
-V--L--L--A--C--E--H--S--F--C--R--A--C--L--A--R--C--W--G--T--P--P--A--T--G--P--E--T--P--P--T--A--C--

----------------------------------------------------------------------------------------------------
P--C--C--G--L--P--C--P--R--R--S--L--R--S--N--V--R--L--A--V--E--V--R--I--S--R--E--L--R--E--K--L--A--E
CCTGCTGCGGCCTGCCGTGTCCCCGCCGCAGCCTGAGGTCTAATGTGCGGCTGGCGGTGGAGGTGCGAATCAGCCGCGAGCTGCGAGAGAAGCTGGCTGA
:::::::::::::::::::.::::::::: ::::::::::::::::::::::::::::::::::::: :::::::: :..:::::.:::::::::::.::
CCTGCTGCGGCCTGCCGTGCCCCCGCCGCTGCCTGAGGTCTAATGTGCGGCTGGCGGTGGAGGTGCGCATCAGCCGAGGACTGCGGGAGAAGCTGGCCGA
P--C--C--G--L--P--C--P--R--R--C--L--R--S--N--V--R--L--A--V--E--V--R--I--S--R--G--L--R--E--K--L--A--E

------------------------------------------------------------------------><---------------------><---
--P--G--A--R--A--G--R--R--R--G--G--R--I--P--T--M--G--C--L--D--L--P--G--E--D--M--R--K--T--W--R--R--F-
GCCTGGGGCCCGTGCGGGGAGACGCCGAGGGGGGCGCATCCCCACCATGGGCTGCCTGGACCTGCCCGGAGAGGATATGAGGAAGACATGGAGACGATTT
:::.::::::::..::::::.::::::::::::::::::::::::::::::::::::::::: ::  ::::::                        :::
GCCCGGGGCCCGCACGGGGAAACGCCGAGGGGGGCGCATCCCCACCATGGGCTGCCTGGACCAGCAGGGAGAG------------------------TTT
--P--G--A--R--T--G--K--R--R--G--G--R--I--P--T--M--G--C--L--D--Q--Q--G--E--------------------------F-

---------------------------------------------------------------------------------------><-----------
-E--V--P--T--S--K--S--S--N--S--E--D--D--L--P--E--D--Y--P--V--V--K--K--M--L--H--R--L--T--A--D--L--T--
GAAGTCCCAACATCCAAGTCATCTAATTCAGAGGATGATCTCCCTGAAGATTATCCAGTGGTCAAAAAAATGCTTCATAGACTGACAGCCGACCTGACCC
:: :.::::::..:::.::::::.::.::::::::.:: ::::: :::::.::.:::::::::::::: ::::::::.:::::::::   ::::::::::
GATGCCCCAACGCCCAGGTCATCCAACTCAGAGGACGAGCTCCCGGAAGACTACCCAGTGGTCAAAAATATGCTTCACAGACTGACA---GACCTGACCC
-D--A--P--T--P--R--S--S--N--S--E--D--E--L--P--E--D--Y--P--V--V--K--N--M--L--H--R--L--T-----D--L--T--

----------------------------------------------------------------------------------------------------
L--D--P--G--T--A--H--R--R--L--L--I--S--A--D--R--R--S--V--Q--L--A--P--P--G--T--P--A--P--P--D--G--P--K
TGGACCCTGGGACCGCACACCGCCGCCTGCTCATCTCCGCCGACCGCCGCAGCGTACAACTGGCCCCACCAGGGACGCCCGCGCCCCCTGACGGCCCCAA
:::::::::: ::::::::.::::::::::::.::::::: :::::::::::::: :.:::::::::::: :::::.:: :.::::::.:::::::::. 
TGGACCCTGGCACCGCACATCGCCGCCTGCTCGTCTCCGCGGACCGCCGCAGCGTCCGACTGGCCCCACCCGGGACACCGGTGCCCCCCGACGGCCCCGC
L--D--P--G--T--A--H--R--R--L--L--V--S--A--D--R--R--S--V--R--L--A--P--P--G--T--P--V--P--P--D--G--P--A

----------------------------------------------------------------------------------------------------
--R--F--D--Q--L--P--A--V--L--G--A--Q--G--F--G--A--G--R--H--C--W--E--V--E--T--A--D--A--A--S--C--R--D-
GCGCTTCGATCAGCTCCCAGCTGTGCTGGGTGCGCAGGGCTTCGGGGCCGGCCGCCACTGCTGGGAGGTGGAGACTGCGGACGCCGCCTCCTGCAGAGAC
::::::.:::::::::::.:: ::::::::.:::::::::::::::::.::::::::::::::::::::::::::.:::::.:::::::::   .:::::
GCGCTTTGATCAGCTCCCGGCGGTGCTGGGCGCGCAGGGCTTCGGGGCTGGCCGCCACTGCTGGGAGGTGGAGACCGCGGATGCCGCCTCC---GGAGAC
--R--F--D--Q--L--P--A--V--L--G--A--Q--G--F--G--A--G--R--H--C--W--E--V--E--T--A--D--A--A--S-----G--D-

----------------------------------------------------------------------------------------------------
-S--S--G--E--D--A--D--D--E--E--S--H--Y--A--V--G--A--A--G--E--S--V--Q--R--K--G--C--V--R--L--C--P--A--
TCTTCTGGGGAGGATGCGGACGACGAGGAGAGCCACTATGCAGTGGGCGCGGCCGGGGAATCAGTGCAACGCAAGGGCTGCGTAAGGCTGTGCCCTGCGG
::::: ::.::::::: ::::::::.::::::::  ::.:: :::::::::::::::::.:: ::::.::::::::::.: :::.::::::::::.:: :
TCTTCGGGAGAGGATGAGGACGACGGGGAGAGCCTNTACGCCGTGGGCGCGGCCGGGGAGTCTGTGCGACGCAAGGGCCGAGTAGGGCTGTGCCCCGCCG
-S--S--G--E--D--E--D--D--G--E--S--X--Y--A--V--G--A--A--G--E--S--V--R--R--K--G--R--V--G--L--C--P--A--

----------------------------------------------------------------------------------------------------
G--A--V--W--A--V--E--G--R--G--G--R--L--W--A--L--T--A--P--E--P--T--L--L--G--G--V--E--P--P--P--R--R--I
GGGCCGTGTGGGCCGTGGAGGGCCGCGGCGGCCGCCTGTGGGCCCTCACGGCACCCGAACCCACCCTGCTGGGCGGTGTTGAGCCCCCGCCGCGGCGCAT
::::::::::::::::::::::.::::::::::::                                                                 
GGGCCGTGTGGGCCGTGGAGGGTCGCGGCGGCCGC-----------------------------------------------------------------
G--A--V--W--A--V--E--G--R--G--G--R------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--V--D--L--D--W--E--R--G--R--V--A--F--Y--D--G--R--S--L--D--L--L--Y--A--F--Q--A--P--G--P--L--G--E-
TCGCGTGGACCTGGACTGGGAGCGGGGCCGCGTGGCCTTCTACGACGGCCGCTCACTCGACCTGCTTTACGCCTTCCAGGCGCCTGGCCCCCTGGGGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------->
-R--I--F--P--L--F--C--T--C--D--P--R--A--P--L--R--I--V--P--A--E--S--*-
CGCATCTTCCCGCTGTTCTGCACCTGCGACCCTCGTGCTCCGCTCCGCATTGTACCAGCGGAAAGCTGA
                                                                     
---------------------------------------------------------------------
---------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000895472
---------------------------------TGGTTGAAGAGAGAGGCGATCCCAGGAGAGGGcaGAAAACGTCCGAAAGTTAATGCGGGAGGCGGAG
AGAGGGGCATCAACGCAACCAGCAGCAGAGGCGCTCAGCCAGCTGCGCGCTCGAAGGCGTTCGCTGGGGTCGCGGAAGGGACGGCGCCCAGACGCTGGCT
CCCCATGAAGGCGCCGGAGCTACTGGGCCCGGGGCTGGTGGAGCGTCTGGAGCAGTTGGCGACGTGCCCGCTGTGCGGGGGCCCCTTCGAGGACCCGGTG
CTCCTGGCGTGTGAGCACAGCTTCTGCCGCGCGTGCCTGGCCCGCTGCTGGGGGACCCCGCCGGCGACGGGCCCCGAGACGCCCCCCACCGCCTGCCCCT
GCTGCGGCCTGCCGTGCCCCCGCCGCTGCCTGAGGTCTAATGTGCGGCTGGCGGTGGAGGTGCGCATCAGCCGAGGACTGCGGGAGAAGCTGGCCGAGCC
CGGGGCCCGCACGGGGAAACGCCGAGGGGGGCGCATCCCCACCATGGGCTGCCTGGACCAGCAGGGA------------------------TTTGATGCC
CCAACGCCCAGGTCATCCAACTCAGAGGACGAGCTCCCGGAAGACTACCCAGTGGTCAAAAATATGCTTCACAGACTGACA---GACCTGACCCTGGACC
CTGGCACCGCACATCGCCGCCTGCTCGTCTCCGCGGACCGCCGCAGCGTCCGACTGGCCCCACCCGGGACACCGGTGCCCCCCGACGGCCCCGCGCGCTT
TGATCAGCTCCCGGCGGTGCTGGGCGCGCAGGGCTTCGGGGCTGGCCGCCACTGCTGGGAGGTGGAGACCGCGGATGCCGCCTCCGGAGACTCTTCGGGA
GAGGATGAGGACGACGGGGAGAGCCTNTACGCCGTGGGCGCGGCCGGGGAGTCTGTGCGACGCAAGGGCCGAGTAGGGCTGTGCCCCGCCGGGGCCGTGT
GGGCCGTGGAGGGTCGCGGCGGCCGC--------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------


>BGISUSP0000895472
-----------WLKREAIPGEGRKRPKVNAGGGERGINATSSRGAQPAARSKAFAGVAEGTAPRRWLPMKAPELLGPGLVERLEQLATCPLCGGPFEDPV
LLACEHSFCRACLARCWGTPPATGPETPPTACPCCGLPCPRRCLRSNVRLAVEVRISRGLREKLAEPGARTGKRRGGRIPTMGCLDQQG--------FDA
PTPRSSNSEDELPEDYPVVKNMLHRLT-DLTLDPGTAHRRLLVSADRRSVRLAPPGTPVPPDGPARFDQLPAVLGAQGFGAGRHCWEVETADAASGDSSG
EDEDDGES-YAVGAAGESVRRKGRVGLCPAGAVWAVEGRGGR----------------------------------------------------------
--------------------