Sequences
EST Library Info
cad3Unavailable
cli1Liver - RNA from China
cly4Lymph - RNA from China
cov1Ovary - RNA from China
csp3Spleen - RNA from China
fbs1Unavailable
med1Mediastinum
nco1Newborn 115 days, colon
Clusters
Oligos
SNPs

Gene ID ENSG00000096158 (click for geneview)
Transcript ID ENST00000244390(link to ensembl)
Symbol LTB
Localtion Chromosome:6:31656314:31658181:-1 band: 6p21.33
Description Lymphotoxin-beta (LT-beta) (Tumor necrosis factor C) (TNF-C) (Tumor necrosis factor ligand superfamily member 3). [Source:Uniprot/SWISSPROT;Acc:Q06643]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--A--L--G--L--E--G--R--G--G--R--L--Q--G--R--G--S--L--L--L--A--V--A--G--A--T--S--L--V--T--L--L--
ATGGGGGCACTGGGGCTGGAGGGCAGGGGTGGGAGGCTCCAGGGGAGGGGTTCCCTCCTGCTAGCTGTGGCAGGAGCCACTTCTCTGGTGACCTTGTTGC
::::::::::.::::::::::::: :::::.::::::.::::::::.::: : :::::::::.::.::::::::.::::::::.:::::::::.: .:::
ATGGGGGCACCGGGGCTGGAGGGCCGGGGTAGGAGGCCCCAGGGGAAGGGATGCCTCCTGCTGGCCGTGGCAGGGGCCACTTCCCTGGTGACCCTCCTGC
-M--G--A--P--G--L--E--G--R--G--R--R--P--Q--G--K--G--C--L--L--L--A--V--A--G--A--T--S--L--V--T--L--L--

-------------------------------------------------------------><-------------------------------------
L--A--V--P--I--T--V--L--A--V--L--A--L--V--P--Q--D--Q--G--G--L--V--T--E--T--A--D--P--G--A--Q--A--Q--Q
TGGCGGTGCCTATCACTGTCCTGGCTGTGCTGGCCTTAGTGCCCCAGGATCAGGGAGGACTGGTAACGGAGACGGCCGACCCCGGGGCACAGGCCCAGCA
:::: ::::::::::: ::::::::::::::::::::.::::::::::: :::::::.::::                                      
TGGCCGTGCCTATCACGGTCCTGGCTGTGCTGGCCTTGGTGCCCCAGGAGCAGGGAGAACTG--------------------------------------
L--A--V--P--I--T--V--L--A--V--L--A--L--V--P--Q--E--Q--G--E--L---------------------------------------

-------><----------------------------------------------------------------------><-------------------
--G--L--G--F--Q--K--L--P--E--E--E--P--E--T--D--L--S--P--G--L--P--A--A--H--L--I--G--A--P--L--K--G--Q-
AGGACTGGGGTTTCAGAAGCTGCCAGAGGAGGAGCCAGAAACAGATCTCAGCCCCGGGCTCCCAGCTGCCCACCTCATAGGCGCTCCGCTGAAGGGGCAG
                      :::::::::::: ::::::::::::::::::::.::::::::::::::::::::      :::. : : : ::: :::
----------------------CCAGAGGAGGAGGCAGAAACAGATCTCAGCCCCAGGCTCCCAGCTGCCCACCTC------GCTTGGATCACGGGTCAG
-----------------------P--E--E--E--A--E--T--D--L--S--P--R--L--P--A--A--H--L--------A--W--I--T--G--Q-

----------------------------------------------------------------------------------------------------
-G--L--G--W--E--T--T--K--E--Q--A--F--L--T--S--G--T--Q--F--S--D--A--E--G--L--A--L--P--Q--D--G--L--Y--
GGGCTAGGCTGGGAGACGACGAAGGAACAGGCGTTTCTGACGAGCGGGACGCAGTTCTCGGACGCCGAGGGGCTGGCGCTCCCGCAGGACGGCCTCTATT
:::::::::::::::.::: :::.::: :::::::::::: :::::::::::::::::: :.::: ::::: ::::: ::::::::::::::::::::.:
GGGCTAGGCTGGGAGGCGAAGAAAGAAGAGGCGTTTCTGAGGAGCGGGACGCAGTTCTCTGGCGCGGAGGGCCTGGCCCTCCCGCAGGACGGCCTCTACT
-G--L--G--W--E--A--K--K--E--E--A--F--L--R--S--G--T--Q--F--S--G--A--E--G--L--A--L--P--Q--D--G--L--Y--

----------------------------------------------------------------------------------------------------
Y--L--Y--C--L--V--G--Y--R--G--R--A--P--P--G--G--G--D--P--Q--G--R--S--V--T--L--R--S--S--L--Y--R--A--G
ACCTCTACTGTCTCGTCGGCTACCGGGGCCGGGCGCCCCCTGGCGGCGGGGACCCCCAGGGCCGCTCGGTCACGCTGCGCAGCTCTCTGTACCGGGCGGG
:::::::::::: :::::::::::::::::::::.::.:::  :::::::::::::: ::.::::::::::::::::: ::::.  ::::::::::::::
ACCTCTACTGTCACGTCGGCTACCGGGGCCGGGCACCTCCTCCCGGCGGGGACCCCCTGGACCGCTCGGTCACGCTGCTCAGCCGGCTGTACCGGGCGGG
Y--L--Y--C--H--V--G--Y--R--G--R--A--P--P--P--G--G--D--P--L--D--R--S--V--T--L--L--S--R--L--Y--R--A--G

----------------------------------------------------------------------------------------------------
--G--A--Y--G--P--G--T--P--E--L--L--L--E--G--A--E--T--V--T--P--V--L--D--P--A--R--R--Q--G--Y--G--P--L-
GGGCGCCTACGGGCCGGGCACTCCCGAGCTGCTGCTCGAGGGCGCCGAGACGGTGACTCCAGTGCTGGACCCGGCCAGGAGACAAGGGTACGGGCCTCTC
::::::::::::.::::: ::::::::::::::::: :::::::: ::::: ::::::::.:: .::::::: . . ::::.:: :.:::::::::.:::
GGGCGCCTACGGACCGGGGACTCCCGAGCTGCTGCTGGAGGGCGCGGAGACTGTGACTCCGGTCTTGGACCCCAGTCGGAGGCACGAGTACGGGCCCCTC
--G--A--Y--G--P--G--T--P--E--L--L--L--E--G--A--E--T--V--T--P--V--L--D--P--S--R--R--H--E--Y--G--P--L-

----------------------------------------------------------------------------------------------------
-W--Y--T--S--V--G--F--G--G--L--V--Q--L--R--R--G--E--R--V--Y--V--N--I--S--H--P--D--M--V--D--F--A--R--
TGGTACACGAGCGTGGGGTTCGGCGGCCTGGTGCAGCTCCGGAGGGGCGAGAGGGTGTACGTCAACATCAGTCACCCCGATATGGTGGACTTCGCGAGAG
:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::.: :. :::::
TGGTACACGAGCGTGGGGTTCGGTGGCCTGGTGCAGCTCCGGAGGGGCGAGAGGGTGTACGTTAATATCAGTCACCCCGATATGGTGGATTACAGGAGAG
-W--Y--T--S--V--G--F--G--G--L--V--Q--L--R--R--G--E--R--V--Y--V--N--I--S--H--P--D--M--V--D--Y--R--R--

---------------------------------->
G--K--T--F--F--G--A--V--M--V--G--*-
GGAAGACCTTCTTTGGGGCCGTGATGGTGGGGTGA
:.:::::::::::.::::: ::::::::::: :::
GAAAGACCTTCTTCGGGGCGGTGATGGTGGGCTGA
G--K--T--F--F--G--A--V--M--V--G--*-

Pig Consensus Sequence

>BGISUST0000888531
ATGGGGGCACCGGGGCTGGAGGGCCGGGGTAGGAGGCCCCAGGGGAAGGGATGCCTCCTGCTGGCCGTGGCAGGGGCCACTTCCCTGGTGACCCTCCTGC
TGGCCGTGCCTATCACGGTCCTGGCTGTGCTGGCCTTGGTGCCCCAGGAGCAGGGAGAACTG--------------------------------------
----------------------CCAGAGGAGGAGGCAGAAACAGATCTCAGCCCCAGGCTCCCAGCTGCCCACCTC------GCTTGGATCACGGGTCAG
GGGCTAGGCTGGGAGGCGAAGAAAGAAGAGGCGTTTCTGAGGAGCGGGACGCAGTTCTCTGGCGCGGAGGGCCTGGCCCTCCCGCAGGACGGCCTCTACT
ACCTCTACTGTCACGTCGGCTACCGGGGCCGGGCACCTCCTCCCGGCGGGGACCCCCTGGACCGCTCGGTCACGCTGCTCAGCCGGCTGTACCGGGCGGG
GGGCGCCTACGGACCGGGGACTCCCGAGCTGCTGCTGGAGGGCGCGGAGACTGTGACTCCGGTCTTGGACCCCAGTCGGAGGCACGAGTACGGGCCCCTC
TGGTACACGAGCGTGGGGTTCGGTGGCCTGGTGCAGCTCCGGAGGGGCGAGAGGGTGTACGTTAATATCAGTCACCCCGATATGGTGGATTACAGGAGAG
GAAAGACCTTCTTCGGGGCGGTGATGGTGGGCTGA


>BGISUSP0000888531
MGAPGLEGRGRRPQGKGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQEQGEL--------------------PEEEAETDLSPRLPAAHL--AWITGQ
GLGWEAKKEEAFLRSGTQFSGAEGLALPQDGLYYLYCHVGYRGRAPPPGGDPLDRSVTLLSRLYRAGGAYGPGTPELLLEGAETVTPVLDPSRRHEYGPL
WYTSVGFGGLVQLRRGERVYVNISHPDMVDYRRGKTFFGAVMVG*