Sequences
EST Library Info
ese3Foetus 50 days, M. semitendinosus
isp2M. Infraspinatus
nep4Newborn 115 days, epidermis
nms23Newborn 115 days, M. semitendinosus
pldo14Unavailable
sme5M. Semimembranosus
ssp27M. Supraspinatus
ste6M. Semitendinosus
vin5M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000125414 (click for geneview)
Transcript ID ENST00000245503(link to ensembl)
Symbol MYH2
Localtion Chromosome:17:10365198:10393700:-1 band: 17p13.1
Description Myosin heavy chain, skeletal muscle, adult 2 (Myosin heavy chain IIa) (MyHC-IIa). [Source:Uniprot/SWISSPROT;Acc:Q9UKX2]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--S--D--S--E--L--A--V--F--G--E--A--A--P--F--L--R--K--S--E--R--E--R--I--E--A--Q--N--R--P--F--D--
ATGAGTTCAGACTCAGAATTGGCTGTTTTTGGGGAGGCTGCTCCTTTCCTCCGAAAGTCTGAAAGGGAGCGCATTGAGGCCCAGAATAGGCCCTTTGATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--K--T--S--V--F--V--A--E--P--K--E--S--F--V--K--G--T--I--Q--S--R--E--G--G--K--V--T--V--K--T--E--G--G
CCAAAACATCTGTCTTTGTGGCGGAGCCCAAAGAATCCTTTGTCAAAGGGACCATCCAGAGCAGAGAAGGAGGAAAAGTGACGGTGAAGACTGAGGGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---><-----------------------------------------------------------------------------------------------
--A--T--L--T--V--K--D--D--Q--V--F--P--M--N--P--P--K--Y--D--K--I--E--D--M--A--M--M--T--H--L--H--E--P-
AGCGACTCTGACAGTGAAGGATGATCAGGTCTTCCCCATGAACCCTCCCAAATATGACAAGATCGAGGATATGGCCATGATGACTCATCTGCATGAGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------><---------------------------------------------------
-A--V--L--Y--N--L--K--E--R--Y--A--A--W--M--I--Y--T--Y--S--G--L--F--C--V--T--V--N--P--Y--K--W--L--P--
GCTGTGCTGTACAACCTCAAAGAACGTTATGCAGCCTGGATGATCTACACCTATTCAGGTCTCTTCTGTGTCACTGTCAACCCCTACAAGTGGCTGCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--Y--K--P--E--V--V--T--A--Y--R--G--K--K--R--Q--E--A--P--P--H--I--F--S--I--S--D--N--A--Y--Q--F--M--L
TGTATAAGCCCGAGGTGGTGACAGCCTACCGAGGCAAAAAGCGCCAGGAGGCCCCGCCCCACATCTTCTCCATCTCTGACAACGCCTATCAGTTCATGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----><--------------------------><------------------------------------------------------------------
--T--D--R--E--N--Q--S--I--L--I--T--G--E--S--G--A--G--K--T--V--N--T--K--R--V--I--Q--Y--F--A--T--I--A-
GACTGACCGAGAGAATCAGTCAATCCTGATCACTGGAGAATCTGGTGCAGGGAAGACTGTGAACACCAAGCGTGTCATCCAGTACTTTGCAACAATTGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------><---------------------------------------------------
-V--T--G--E--K--K--K--E--E--I--T--S--G--K--I--Q--G--T--L--E--D--Q--I--I--S--A--N--P--L--L--E--A--F--
GTTACTGGTGAGAAGAAGAAGGAAGAAATTACTTCTGGCAAAATACAGGGGACTCTGGAAGATCAAATCATCAGTGCCAACCCCCTACTGGAGGCCTTTG
                                                :::::::::::::::::.::::::::::::::::: ::.:::::::::::::
------------------------------------------------GGGACTCTGGAAGATCAGATCATCAGTGCCAACCCGCTGCTGGAGGCCTTTG
-------------------------------------------------G--T--L--E--D--Q--I--I--S--A--N--P--L--L--E--A--F--

----------------------------------------><----------------------------------------------------------
G--N--A--K--T--V--R--N--D--N--S--S--R--F--G--K--F--I--R--I--H--F--G--T--T--G--K--L--A--S--A--D--I--E
GCAACGCCAAGACCGTGAGGAATGACAACTCCTCTCGCTTTGGTAAATTCATCAGAATCCACTTTGGCACTACTGGAAAACTGGCATCTGCTGATATTGA
::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::: ::::::::::: ::::::::::::::
GCAACGCCAAGACCGTGAGGAATGACAACTCCTCTCGCTTTGGTAAATTCATTAGAATCCACTTTGGCACTACAGGAAAACTGGCTTCTGCTGATATTGA
G--N--A--K--T--V--R--N--D--N--S--S--R--F--G--K--F--I--R--I--H--F--G--T--T--G--K--L--A--S--A--D--I--E

----><----------------------------------------------------------------------------------------------
--T--Y--L--L--E--K--S--R--V--V--F--Q--L--K--A--E--R--S--Y--H--I--F--Y--Q--I--T--S--N--K--K--P--E--L-
AACATATCTGCTAGAGAAGTCTAGAGTTGTTTTCCAGCTTAAGGCTGAGAGAAGTTATCATATTTTTTACCAGATTACATCGAATAAGAAACCAGAACTT
::::   :::.:::::::::::::.:::..::::::::::::::::::.::.::.:::::.::::::::.:::::.:::::.::.:.::::::::::::.
AACA---CTGTTAGAGAAGTCTAGGGTTACTTTCCAGCTTAAGGCTGAAAGGAGCTATCACATTTTTTATCAGATCACATCAAACAGGAAACCAGAACTC
--T-----L--L--E--K--S--R--V--T--F--Q--L--K--A--E--R--S--Y--H--I--F--Y--Q--I--T--S--N--R--K--P--E--L-

---><-----------------------------------------------------------------------------------------------
-I--E--M--L--L--I--T--T--N--P--Y--D--Y--P--F--V--S--Q--G--E--I--S--V--A--S--I--D--D--Q--E--E--L--M--
ATTGAAATGCTTCTGATTACCACGAACCCATATGATTACCCATTTGTCAGTCAAGGGGAGATCAGTGTGGCCAGCATCGATGATCAGGAAGAACTGATGG
:::   :::::::::::.::::: ::::::::::::::::::::..::::::::::::::::::::::.::::::::.::::::::::::::::::::.:
ATT---ATGCTTCTGATCACCACCAACCCATATGATTACCCATTCATCAGTCAAGGGGAGATCAGTGTAGCCAGCATTGATGATCAGGAAGAACTGATAG
-I-----M--L--L--I--T--T--N--P--Y--D--Y--P--F--I--S--Q--G--E--I--S--V--A--S--I--D--D--Q--E--E--L--I--

-------><-------------------------------------------------------------------------------------------
A--T--D--S--A--I--D--I--L--G--F--T--N--E--E--K--V--S--I--Y--K--L--T--G--A--V--M--H--Y--G--N--L--K--F
CCACAGATAGTGCTATTGATATTTTGGGCTTTACTAATGAAGAAAAGGTCTCCATTTACAAGCTCACGGGGGCTGTGATGCATTATGGGAACCTAAAATT
::::::::                  :::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::.:::.:::::::
CCACAGAT------------------GGCTTTACTAATGAAGAGAAGGTCTCCATTTACAAGCTCACGGGAGCTGTGATGCATTATGGAAACTTAAAATT
A--T--D--------------------G--F--T--N--E--E--K--V--S--I--Y--K--L--T--G--A--V--M--H--Y--G--N--L--K--F

----------------------------------------------><----------------------------------------------------
--K--Q--K--Q--R--E--E--Q--A--E--P--D--G--T--E--V--A--D--K--A--A--Y--L--Q--S--L--N--S--A--D--L--L--K-
TAAGCAAAAGCAGCGTGAGGAGCAAGCAGAGCCAGATGGCACAGAAGTTGCTGACAAGGCGGCCTACCTCCAGAGTCTGAACTCTGCAGATCTGCTCAAA
.::::::::.::::::::.:::::::::::::::::.:::::.:::   :::::::::::.::::::::.::::::::::::::::: ::.:::::::::
CAAGCAAAAACAGCGTGAAGAGCAAGCAGAGCCAGACGGCACGGAA---GCTGACAAGGCAGCCTACCTTCAGAGTCTGAACTCTGCTGACCTGCTCAAA
--K--Q--K--Q--R--E--E--Q--A--E--P--D--G--T--E-----A--D--K--A--A--Y--L--Q--S--L--N--S--A--D--L--L--K-

--------------------------------------------------------------------><------------------------------
-A--L--C--Y--P--R--V-----K--V--G--N--E--Y--V--T--K--G--Q--T--V--E--Q--V--S--N--A--V--G--A--L--A--K--
GCTCTCTGCTACCCCAGGGTC---AAGGTCGGCAATGAGTATGTCACCAAAGGCCAGACTGTAGAACAGGTGTCCAACGCAGTAGGTGCTCTGGCCAAAG
::.:::::::::::::::::.   ::::::::::::::.:::::::::::::::::::: :::::.:::::: ::::.:::::.::::::::::::::::
GCCCTCTGCTACCCCAGGGTTC--AAGGTCGGCAATGAATATGTCACCAAAGGCCAGACAGTAGAGCAGGTGACCAATGCAGTGGGTGCTCTGGCCAAAG
-A--L--C--Y--P--R--V--\--K--V--G--N--E--Y--V--T--K--G--Q--T--V--E--Q--V--T--N--A--V--G--A--L--A--K--

----------------------------------------------------------------------------------------------------
A--V--Y--E--K--M--F--L--W--M--V--A--R--I--N--Q--Q--L--D--T--K--Q--P--R--Q--Y--F--I--G--V--L--D--I--A
CCGTCTACGAGAAGATGTTCCTGTGGATGGTTGCCCGCATCAACCAGCAGCTGGACACCAAGCAGCCCAGGCAGTACTTCATCGGGGTCTTGGACATTGC
:::::::::::::::::::::::::::::::..:.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::
CCGTCTACGAGAAGATGTTCCTGTGGATGGTCACTCGCATCAACCAGCAGCTGGACACCAAGCAGCCCAGGCAGTACTTCATCGGGGTCTTGGACATCGC
A--V--Y--E--K--M--F--L--W--M--V--T--R--I--N--Q--Q--L--D--T--K--Q--P--R--Q--Y--F--I--G--V--L--D--I--A

------------------><--------------------------------------------------------------------------------
--G--F--E--I--F--D--F--N--S--L--E--Q--L--C--I--N--F--T--N--E--K--L--Q--Q--F--F--N--H--H--M--F--V--L-
TGGTTTTGAGATTTTTGATTTCAACAGCCTGGAGCAGCTGTGCATCAACTTCACCAATGAGAAACTGCAACAGTTTTTCAACCACCACATGTTCGTGCTG
.::.::::::::.::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CGGCTTTGAGATCTTTGATTTTAACAGCCTGGAGCAGCTGTGCATCAACTTCACCAATGAGAAACTGCAACAGTTTTTCAACCACCACATGTTCGTGCTG
--G--F--E--I--F--D--F--N--S--L--E--Q--L--C--I--N--F--T--N--E--K--L--Q--Q--F--F--N--H--H--M--F--V--L-

-----------------------------------------------------------------------------------------><---------
-E--Q--E--E--Y--K--K--E--G--I--E--W--T--F--I--D--F--G--M--D--L--A--A--C--I--E--L--I--E--K--P--M--G--
GAGCAGGAGGAGTACAAGAAGGAAGGCATCGAGTGGACGTTCATCGACTTCGGGATGGACCTGGCTGCCTGCATCGAGCTCATCGAGAAGCCTATGGGCA
::::::::::::::.::::.::::::::::::::::::::.:::.::::: ::::::::::::::.::::::::::::::::::::::::          
GAGCAGGAGGAGTATAAGAGGGAAGGCATCGAGTGGACGTCCATTGACTTAGGGATGGACCTGGCCGCCTGCATCGAGCTCATCGAGAAG----------
-E--Q--E--E--Y--K--R--E--G--I--E--W--T--S--I--D--L--G--M--D--L--A--A--C--I--E--L--I--E--K-----------

----------------------------------------------------------------------------------------------------
I--F--S--I--L--E--E--E--C--M--F--P--K--A--T--D--T--S--F--K--N--K--L--Y--D--Q--H--L--G--K--S--A--N--F
TCTTCTCCATCCTGGAAGAGGAGTGCATGTTCCCTAAGGCAACAGACACCTCCTTCAAGAACAAGCTGTATGACCAGCACCTGGGCAAGTCTGCCAACTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--K--P--K--V--V--K--G--K--A--E--A--H--F--A--L--I--H--Y--A--G--V--V--D--Y--N--I--T--G--W--L--E--K-
CCAGAAGCCCAAGGTGGTCAAAGGCAAGGCCGAGGCCCACTTCGCTCTGATTCACTATGCTGGTGTTGTGGACTACAACATTACTGGCTGGCTGGAGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------->
-N--K--D--P--L--N--E--T--V--V--G--L--Y--Q--K--S--A--M--K--T--L--A--Q--L--F--S--G--A--Q--T--A--E--G--
AACAAGGACCCCCTGAATGAGACCGTGGTTGGACTGTACCAGAAGTCTGCAATGAAAACTCTAGCTCAGCTCTTCTCTGGGGCTCAAACTGCTGAAGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

<---------------------------------------------------------------------------><----------------------
E--G--A--G--G--G--A--K--K--G--G--K--K--K--G--S--S--F--Q--T--V--S--A--L--F--R--E--N--L--N--K--L--M--T
AGGGAGCTGGTGGAGGGGCCAAGAAAGGTGGTAAGAAGAAGGGCTCTTCTTTCCAGACAGTGTCTGCCCTTTTCAGAGAGAATTTGAACAAGCTGATGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------><----------------------------------
--N--L--R--S--T--H--P--H--F--V--R--C--I--I--P--N--E--T--K--T--P--G--A--M--E--H--E--L--V--L--H--Q--L-
CAACCTCAGGAGTACCCATCCTCACTTTGTGAGGTGTATCATCCCCAATGAGACAAAAACTCCTGGTGCCATGGAGCATGAGCTTGTCCTCCACCAGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------><----------------
-R--C--N--G--V--L--E--G--I--R--I--C--R--K--G--F--P--S--R--I--L--Y--A--D--F--K--Q--R--Y--K--V--L--N--
AGGTGTAACGGTGTGCTGGAAGGCATCCGCATCTGTAGGAAAGGATTTCCAAGCAGAATCCTTTATGCAGACTTCAAACAGAGATACAAGGTATTAAATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--S--A--I--P--E--G--Q--F--I--D--S--K--K--A--S--E--K--L--L--A--S--I--D--I--D--H--T--Q--Y--K--F--G--H
CAAGTGCAATCCCTGAAGGGCAATTCATTGATAGCAAGAAGGCCTCTGAGAAGCTCCTTGCATCCATCGACATTGACCACACCCAGTATAAATTTGGGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------><--------------------------------------------------------------------------------------------
--T--K--V--F--F--K--A--G--L--L--G--L--L--E--E--M--R--D--D--K--L--A--Q--L--I--T--R--T--Q--A--R--C--R-
CACCAAGGTCTTTTTCAAAGCTGGTCTTCTGGGGCTCCTAGAGGAGATGCGAGATGACAAGCTGGCCCAGCTGATTACCCGAACCCAGGCCAGGTGCAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------><-------------------------------------------------------
-G--F--L--A--R--V--E--Y--Q--R--M--V--E--R--R--E--A--I--F--C--I--Q--Y--N--I--R--S--F--M--N--V--K--H--
GGGTTCTTGGCAAGAGTGGAGTACCAGAGGATGGTGGAGAGAAGGGAGGCCATCTTCTGTATCCAGTACAATATCAGATCCTTCATGAATGTCAAGCACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
W--P--W--M--K--L--F--F--K--I--K--P--L--L--K--S--A--E--T--E--K--E--M--A--T--M--K--E--E--F--Q--K--I--K
GGCCCTGGATGAAACTCTTCTTCAAGATCAAGCCTCTGTTGAAGAGTGCAGAAACTGAGAAGGAGATGGCCACCATGAAGGAAGAATTTCAGAAAATTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------->
--D--E--L--A--K--S--E--A--K--R--K--E--L--E--E--K--M--V--T--L--L--K--E--K--N--D--L--Q--L--Q--V--Q--A-
AGACGAACTTGCCAAGTCAGAGGCAAAAAGGAAGGAACTGGAAGAAAAGATGGTGACGCTGTTGAAAGAAAAAAATGACTTGCAGCTCCAAGTTCAGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

<---------------------------------------------------------------------------------------------------
-E--A--E--G--L--A--D--A--E--E--R--C--D--Q--L--I--K--T--K--I--Q--L--E--A--K--I--K--E--V--T--E--R--A--
GAAGCCGAAGGCTTGGCTGATGCAGAGGAAAGGTGTGACCAGCTAATCAAAACCAAAATCCAGCTAGAAGCCAAAATCAAAGAGGTGACTGAGAGAGCTG
:::::.::::::::::::::::::::::::::.:::::::::::.::::::::::::::::::::.::.:::::::::::.:::::::::::::::::::
GAAGCTGAAGGCTTGGCTGATGCAGAGGAAAGATGTGACCAGCTGATCAAAACCAAAATCCAGCTGGAGGCCAAAATCAAGGAGGTGACTGAGAGAGCTG
-E--A--E--G--L--A--D--A--E--E--R--C--D--Q--L--I--K--T--K--I--Q--L--E--A--K--I--K--E--V--T--E--R--A--

----------------------------------------------------------------------------------------------------
E--D--E--E--E--I--N--A--E--L--T--A--K--K--R--K--L--E--D--E--C--S--E--L--K--K--D--I--D--D--L--E--L--T
AGGATGAGGAAGAGATCAATGCTGAGCTGACAGCCAAGAAGAGGAAACTGGAGGATGAATGTTCAGAACTCAAGAAAGACATTGATGACCTTGAGCTGAC
::::::::::::::::::::::.::::::::.::::::::::::::::::::::::::.::.:::::::: :::::::::::.:::::::::::::::::
AGGATGAGGAAGAGATCAATGCCGAGCTGACGGCCAAGAAGAGGAAACTGGAGGATGAGTGCTCAGAACTGAAGAAAGACATCGATGACCTTGAGCTGAC
E--D--E--E--E--I--N--A--E--L--T--A--K--K--R--K--L--E--D--E--C--S--E--L--K--K--D--I--D--D--L--E--L--T

------------------------------------------><--------------------------------------------------------
--L--A--K--V--E--K--E--K--H--A--T--E--N--K--V--K--N--L--T--E--E--M--A--G--L--D--E--T--I--A--K--L--T-
ACTGGCCAAGGTTGAGAAGGAGAAACATGCCACAGAAAACAAGGTGAAAAACCTCACAGAAGAGATGGCAGGTCTGGATGAAACCATTGCTAAGCTGACC
:::::::::::::::.::::::::::::::::::::.::::::::::::::::::::.::::::::::::::.:::::.::::::::::: :::::::::
ACTGGCCAAGGTTGAAAAGGAGAAACATGCCACAGAGAACAAGGTGAAAAACCTCACGGAAGAGATGGCAGGCCTGGACGAAACCATTGCAAAGCTGACC
--L--A--K--V--E--K--E--K--H--A--T--E--N--K--V--K--N--L--T--E--E--M--A--G--L--D--E--T--I--A--K--L--T-

----------------------------------------------------------------------------------------------------
-K--E--K--K--A--L--Q--E--A--H--Q--Q--T--L--D--D--L--Q--A--E--E--D--K--V--N--T--L--T--K--A--K--I--K--
AAGGAGAAGAAGGCTCTCCAGGAGGCCCACCAGCAGACCCTGGATGACCTGCAGGCAGAGGAGGACAAAGTCAACACCCTGACCAAAGCTAAAATCAAAC
::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::: ::::::::::..:::.:
AAGGAGAAGAAGGCCCTCCAGGAGGCCCACCAGCAGACCCTGGATGACCTGCAGGCAGAAGAGGACAAAGTCAACACCCTGAACAAAGCTAAAGCCAAGC
-K--E--K--K--A--L--Q--E--A--H--Q--Q--T--L--D--D--L--Q--A--E--E--D--K--V--N--T--L--N--K--A--K--A--K--

-------------------><-------------------------------------------------------------------------------
L--E--Q--Q--V--D--D--L--E--G--S--L--E--Q--E--K--K--L--R--M--D--L--E--R--A--K--R--K--L--E--G--D--L--K
TTGAACAACAAGTGGATGATCTTGAAGGGTCCTTGGAGCAAGAAAAGAAACTTCGCATGGACCTAGAAAGGGCTAAGAGGAAACTTGAGGGTGACTTGAA
: ::.::.::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::.::.::.::::::::::: ::.::::::.: ::
TAGAGCAGCAAGTGGATGATCTTGAAGGGTCCTTGGAGCAAGAAAAGAAACTTCGCATGGACTTAGAGAGAGCCAAGAGGAAACTGGAAGGTGACCTCAA
L--E--Q--Q--V--D--D--L--E--G--S--L--E--Q--E--K--K--L--R--M--D--L--E--R--A--K--R--K--L--E--G--D--L--K

-----------------------------------------------------------------><---------------------------------
--L--A--Q--E--S--I--M--D--I--E--N--E--K--Q--Q--L--D--E--K--L--K--K--K--E--F--E--I--S--N--L--Q--S--K-
GTTGGCCCAAGAATCCATAATGGACATTGAAAATGAGAAACAGCAACTTGATGAAAAGCTCAAAAAGAAAGAGTTTGAAATCAGCAATCTGCAAAGCAAG
::::::.:::::.:::::::::::::::::.:::::.:::::::::::::::::::::::.:::   :::::::::::::: ::::::.:.:::::::::
GTTGGCTCAAGAGTCCATAATGGACATTGAGAATGAAAAACAGCAACTTGATGAAAAGCTTAAA---AAAGAGTTTGAAATAAGCAATTTACAAAGCAAG
--L--A--Q--E--S--I--M--D--I--E--N--E--K--Q--Q--L--D--E--K--L--K-----K--E--F--E--I--S--N--L--Q--S--K-

--------------------------------------------------------><------------------------------------------
-I--E--D--E--Q--A--L--G--I--Q--L--Q--K--K--I--K--E--L--Q--A--R--I--E--E--L--E--E--E--I--E--A--E--R--
ATTGAAGATGAACAGGCACTTGGCATTCAATTGCAGAAGAAAATTAAAGAATTGCAAGCCCGCATTGAGGAGCTGGAGGAGGAAATCGAGGCAGAGCGGG
::::::::::::::.::::::: ::::::..::::.:::::.::.:::::.::::::::::::::::::::::: ::.:::::.::::::::::::::::
ATTGAAGATGAACAAGCACTTGCCATTCAGCTGCAAAAGAAGATCAAAGAGTTGCAAGCCCGCATTGAGGAGCTTGAAGAGGAGATCGAGGCAGAGCGGG
-I--E--D--E--Q--A--L--A--I--Q--L--Q--K--K--I--K--E--L--Q--A--R--I--E--E--L--E--E--E--I--E--A--E--R--

----------------------------------------------------------------------------------------------------
A--S--R--A--K--A--E--K--Q--R--S--D--L--S--R--E--L--E--E--I--S--E--R--L--E--E--A--G--G--A--T--S--A--Q
CCTCCCGGGCCAAAGCAGAGAAGCAGCGCTCTGACCTCTCCCGGGAGCTGGAGGAGATCAGCGAGAGGCTGGAAGAAGCCGGTGGGGCCACTTCAGCCCA
::::: :::::::::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::::::::::::::.::::: :: ::::::::
CCTCCAGGGCCAAAGCAGAGAAGCAGCGCTCCGACCTCTCCCGGGAACTGGAGGAGATCAGCGAGAGGCTGGAAGAAGCCGGCGGGGCGACGTCAGCCCA
A--S--R--A--K--A--E--K--Q--R--S--D--L--S--R--E--L--E--E--I--S--E--R--L--E--E--A--G--G--A--T--S--A--Q

----------------------------------------------------------------------------------------------------
--I--E--M--N--K--K--R--E--A--E--F--Q--K--M--R--R--D--L--E--E--A--T--L--Q--H--E--A--T--A--A--T--L--R-
GATTGAGATGAACAAGAAGCGGGAGGCTGAGTTCCAGAAAATGCGCAGGGACCTGGAGGAGGCCACCCTACAGCATGAAGCCACAGCGGCCACCCTGAGG
::::::::::::::::::::: :::::::::::::::::.:::::: ::::::::::::::::::::::.::::::::.::::::::::::.: .:::::
GATTGAGATGAACAAGAAGCGCGAGGCTGAGTTCCAGAAGATGCGCCGGGACCTGGAGGAGGCCACCCTGCAGCATGAGGCCACAGCGGCCGCGTTGAGG
--I--E--M--N--K--K--R--E--A--E--F--Q--K--M--R--R--D--L--E--E--A--T--L--Q--H--E--A--T--A--A--A--L--R-

----------------------------------------------------------------------------------------------------
-K--K--H--A--D--S--V--A--E--L--G--E--Q--I--D--N--L--Q--R--V--K--Q--K--L--E--K--E--K--S--E--M--K--M--
AAGAAGCATGCAGATAGTGTGGCCGAGCTTGGGGAGCAGATTGACAACCTGCAGCGAGTGAAGCAGAAGCTGGAGAAGGAGAAGAGTGAGATGAAGATGG
::::::::.::.::.::.:::::.::::: :::::::::::.:::::::::::: :.:: ::::::::::::::::::::::::::::::::::::::::
AAGAAGCACGCGGACAGCGTGGCTGAGCTGGGGGAGCAGATCGACAACCTGCAGAGGGTCAAGCAGAAGCTGGAGAAGGAGAAGAGTGAGATGAAGATGG
-K--K--H--A--D--S--V--A--E--L--G--E--Q--I--D--N--L--Q--R--V--K--Q--K--L--E--K--E--K--S--E--M--K--M--

----------------------------------------------><----------------------------------------------------
E--I--D--D--L--A--S--N--V--E--T--V--S--K--A--K--G--N--L--E--K--M--C--R--T--L--E--D--Q--L--S--E--L--K
AGATTGATGACCTTGCTAGTAATGTAGAAACGGTCTCCAAAGCCAAGGGAAACCTAGAGAAAATGTGCCGGACTCTAGAGGACCAACTGAGTGAACTGAA
::::.::.:::::::::::.::..:.::.:: :::::::::::::::::::::::::::::.:::::::: :::::.::::::::.:::::.::.:::::
AGATCGACGACCTTGCTAGCAACATGGAGACCGTCTCCAAAGCCAAGGGAAACCTAGAGAAGATGTGCCGCACTCTGGAGGACCAGCTGAGCGAGCTGAA
E--I--D--D--L--A--S--N--M--E--T--V--S--K--A--K--G--N--L--E--K--M--C--R--T--L--E--D--Q--L--S--E--L--K

-------------------------------------------------------------------------><-------------------------
--S--K--E--E--E--Q--Q--R--L--I--N--D--L--T--A--Q--R--G--R--L--Q--T--E--S--G--E--F--S--R--Q--L--D--E-
ATCAAAGGAAGAGGAGCAGCAGCGGCTGATCAATGACCTGACTGCGCAGAGGGGGCGCCTGCAGACTGAATCTGGTGAGTTTTCACGCCAGCTTGATGAA
::: :::::.::.::::::::::::::::::::.:::::::: :: ::::::::.::.:::::::: ::::::   ::.::::::::.::::: ::::::
ATCCAAGGAGGAAGAGCAGCAGCGGCTGATCAACGACCTGACGGCTCAGAGGGGACGTCTGCAGACAGAATCT---GAATTTTCACGTCAGCTAGATGAA
--S--K--E--E--E--Q--Q--R--L--I--N--D--L--T--A--Q--R--G--R--L--Q--T--E--S-----E--F--S--R--Q--L--D--E-

--------------------------------------------------------------------------------------------><------
-K--E--A--L--V--S--Q--L--S--R--G--K--Q--A--F--T--Q--Q--I--E--E--L--K--R--Q--L--E--E--E--I--K--A--K--
AAGGAAGCTCTGGTGTCTCAGTTATCAAGAGGCAAACAAGCCTTTACTCAACAGATTGAAGAATTAAAGAGGCAACTTGAAGAGGAGATAAAAGCCAAGA
::.::::::::::::::::::::::::::.::::::::::: : :::::::::::::::.::::::::::::::::::::.:::::::::   :::::::
AAAGAAGCTCTGGTGTCTCAGTTATCAAGGGGCAAACAAGCATATACTCAACAGATTGAGGAATTAAAGAGGCAACTTGAGGAGGAGATA---GCCAAGA
-K--E--A--L--V--S--Q--L--S--R--G--K--Q--A--Y--T--Q--Q--I--E--E--L--K--R--Q--L--E--E--E--I-----A--K--

----------------------------------------------------------------------------------------------------
N--A--L--A--H--A--L--Q--S--S--R--H--D--C--D--L--L--R--E--Q--Y--E--E--E--Q--E--S--K--A--E--L--Q--R--A
ACGCCCTGGCGCATGCCCTGCAGTCTTCCCGCCACGACTGTGACCTGCTGCGGGAACAGTATGAGGAGGAGCAGGAATCCAAGGCCGAGCTGCAGAGAGC
:.:::::::::::.::.::::::::.::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::
ATGCCCTGGCGCACGCTCTGCAGTCCTCCCGCCACGACTGCGACCTGCTGCGGGAACAGTATGAGGAGGAGCAGGAATCCAAGGCCGAGCTGCAGAGGGC
N--A--L--A--H--A--L--Q--S--S--R--H--D--C--D--L--L--R--E--Q--Y--E--E--E--Q--E--S--K--A--E--L--Q--R--A

-----------------------------------------------------------------------------------------><---------
--L--S--K--A--N--T--E--V--A--Q--W--R--T--K--Y--E--T--D--A--I--Q--R--T--E--E--L--E--E--A--K--K--K--L-
ACTGTCCAAGGCCAACACCGAGGTTGCCCAATGGAGGACCAAATACGAGACGGACGCCATCCAGCGCACAGAGGAGCTGGAGGAGGCCAAGAAGAAGCTG
.::::::::::::::::: :::::::::::.:::::::::::.:::::::::::::::::::::::::: ::::::::::::::::::   :::::.:::
GCTGTCCAAGGCCAACACAGAGGTTGCCCAGTGGAGGACCAAGTACGAGACGGACGCCATCCAGCGCACCGAGGAGCTGGAGGAGGCC---AAGAAACTG
--L--S--K--A--N--T--E--V--A--Q--W--R--T--K--Y--E--T--D--A--I--Q--R--T--E--E--L--E--E--A-----K--K--L-

----------------------------------------------------------------------------------------------------
-A--Q--R--L--Q--A--A--E--E--H--V--E--A--V--N--A--K--C--A--S--L--E--K--T--K--Q--R--L--Q--N--E--V--E--
GCCCAGCGGCTGCAGGCAGCTGAGGAACATGTAGAAGCTGTGAACGCCAAATGTGCTTCCCTCGAAAAGACGAAGCAGCGGCTGCAGAATGAGGTCGAGG
:::::: ::::::::::::::::::::::.::.:::::::::::::::::.::::::::::::::.::::::::::::::::: ::::::::::::::::
GCCCAGAGGCTGCAGGCAGCTGAGGAACACGTGGAAGCTGTGAACGCCAAGTGTGCTTCCCTCGAGAAGACGAAGCAGCGGCTCCAGAATGAGGTCGAGG
-A--Q--R--L--Q--A--A--E--E--H--V--E--A--V--N--A--K--C--A--S--L--E--K--T--K--Q--R--L--Q--N--E--V--E--

-------------------------------------------------------------------------><-------------------------
D--L--M--L--D--V--E--R--T--N--A--A--C--A--A--L--D--K--K--Q--R--N--F--D--K--I--L--A--E--W--K--Q--K--C
ACCTCATGCTTGATGTGGAGAGGACAAATGCCGCCTGTGCCGCCCTTGACAAAAAGCAAAGGAACTTCGATAAGATCCTGGCAGAATGGAAACAGAAATG
::::::::::.:::::::::::::: ::.::.:::::.:: ::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.:.
ACCTCATGCTCGATGTGGAGAGGACCAACGCTGCCTGCGCAGCCCTTGACAAAAAGCAAAGGAACTTCGATAAGATCCTGGCAGAGTGGAAACAGAAGTA
D--L--M--L--D--V--E--R--T--N--A--A--C--A--A--L--D--K--K--Q--R--N--F--D--K--I--L--A--E--W--K--Q--K--Y

----------------------------------------------------------------------------------------------------
--E--E--T--H--A--E--L--E--A--S--Q--K--E--A--R--S--L--G--T--E--L--F--K--I--K--N--A--Y--E--E--S--L--D-
TGAGGAAACGCATGCTGAGCTTGAGGCCTCCCAGAAGGAGGCCCGTTCCCTTGGCACTGAGCTGTTCAAGATAAAGAATGCCTATGAGGAATCTTTGGAT
::::::::: ::.:: ::::::::.::::::::::::::::::::.::.::.::::::::::::::::::::.:::::::::::::::::.::..: :::
TGAGGAAACCCACGCGGAGCTTGAAGCCTCCCAGAAGGAGGCCCGCTCTCTCGGCACTGAGCTGTTCAAGATGAAGAATGCCTATGAGGAGTCCCTTGAT
--E--E--T--H--A--E--L--E--A--S--Q--K--E--A--R--S--L--G--T--E--L--F--K--M--K--N--A--Y--E--E--S--L--D-

---------------------------------------><-----------------------------------------------------------
-Q--L--E--T--L--K--R--E--N--K--N--L--Q--Q--E--I--S--D--L--T--E--Q--I--A--E--G--G--K--R--I--H--E--L--
CAGCTAGAAACCCTGAAGCGAGAGAACAAAAACTTACAGCAGGAGATTTCTGACCTCACGGAACAGATTGCAGAAGGAGGGAAACGTATCCATGAACTGG
:::::::::::..::::.:::::::::::::::::.:::   ::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::
CAGCTAGAAACTTTGAAACGAGAGAACAAAAACTTGCAG---GAGATTTCTGACCTCACGGAGCAGATTGCAGAAGGAGGGAAACGTATCCATGAACTGG
-Q--L--E--T--L--K--R--E--N--K--N--L--Q-----E--I--S--D--L--T--E--Q--I--A--E--G--G--K--R--I--H--E--L--

----------------------------------------------------------------><----------------------------------
E--K--I--K--K--Q--V--E--Q--E--K--C--E--L--Q--A--A--L--E--E--A--E--A--S--L--E--H--E--E--G--K--I--L--R
AGAAAATAAAGAAACAAGTGGAACAAGAAAAGTGTGAACTTCAGGCTGCTTTAGAAGAAGCAGAGGCATCTCTTGAACATGAAGAGGGAAAGATCCTGCG
::::::::::::::::::::::::::::::::: :::. ::::::::::::::::.:::::::::::::::::::::::.:::::.::::::::.:::::
AGAAAATAAAGAAACAAGTGGAACAAGAAAAGTCTGAGATTCAGGCTGCTTTAGAGGAAGCAGAGGCATCTCTTGAACACGAAGAAGGAAAGATTCTGCG
E--K--I--K--K--Q--V--E--Q--E--K--S--E--I--Q--A--A--L--E--E--A--E--A--S--L--E--H--E--E--G--K--I--L--R

----------------------------------------------------------------------------------------------------
--I--Q--L--E--L--N--Q--V--K--S--E--V--D--R--K--I--A--E--K--D--E--E--I--D--Q--L--K--R--N--H--I--R--I-
CATCCAGCTTGAGTTGAACCAAGTCAAGTCTGAGGTTGATAGGAAAATTGCTGAAAAAGATGAGGAAATTGACCAGCTGAAGAGAAACCACATTAGAATC
::::::::: :::::::::::::::::::: ::::: ::.::::::::.:::::.::.:::::::::::.::::::::::::::.::::::.:.:::.::
CATCCAGCTGGAGTTGAACCAAGTCAAGTCGGAGGTGGACAGGAAAATCGCTGAGAAGGATGAGGAAATCGACCAGCTGAAGAGGAACCACGTCAGAGTC
--I--Q--L--E--L--N--Q--V--K--S--E--V--D--R--K--I--A--E--K--D--E--E--I--D--Q--L--K--R--N--H--V--R--V-

----------------------------------------------------------------------------------------------------
-V--E--S--M--Q--S--T--L--D--A--E--I--R--S--R--N--D--A--I--R--L--K--K--K--M--E--G--D--L--N--E--M--E--
GTGGAGTCCATGCAGAGCACGCTGGATGCTGAGATCAGGAGTAGGAATGATGCCATTAGGCTCAAGAAGAAGATGGAGGGAGACCTCAATGAAATGGAAA
:::::::::::::::::::.:::::::::::::::: ::::.::.::.::::::::.:::::::::::::::::::::::::::::::::::::::::::
GTGGAGTCCATGCAGAGCATGCTGGATGCTGAGATCCGGAGCAGAAACGATGCCATCAGGCTCAAGAAGAAGATGGAGGGAGACCTCAATGAAATGGAAA
-V--E--S--M--Q--S--M--L--D--A--E--I--R--S--R--N--D--A--I--R--L--K--K--K--M--E--G--D--L--N--E--M--E--

-------------------------------------------------------------------------><-------------------------
I--Q--L--N--H--A--N--R--M--A--A--E--A--L--R--N--Y--R--N--T--Q--G--I--L--K--D--T--Q--I--H--L--D--D--A
TCCAGCTGAACCATGCCAACCGCATGGCTGCTGAGGCCCTGAGGAACTACAGGAACACCCAAGGCATCCTCAAGGATACCCAGATCCACCTGGATGATGC
:::::::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::.::
TCCAGCTGAACCACGCCAACCGCATGGCTGCCGAGGCCCTGAGGAACTACAGGAACACCCAAGGCATCCTCAAGGACACCCAGATCCACCTGGATGACGC
I--Q--L--N--H--A--N--R--M--A--A--E--A--L--R--N--Y--R--N--T--Q--G--I--L--K--D--T--Q--I--H--L--D--D--A

----------------------------------------------------------------------------------------------------
--L--R--S--Q--E--D--L--K--E--Q--L--A--M--V--E--R--R--A--N--L--L--Q--A--E--I--E--E--L--R--A--T--L--E-
TCTCCGGAGCCAGGAGGACCTGAAGGAACAGCTGGCCATGGTGGAGCGCAGAGCCAACCTGCTGCAGGCTGAGATCGAGGAGCTGCGGGCCACTCTGGAA
:::: ::.::::.::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::: :::::.
TCTCAGGGGCCAAGAGGACCTGAAGGAGCAGCTGGCCATGGTGGAGCGCAGAGCCAACCTGCTGCAGGCTGAGATTGAGGAGCTGCGGGCCACGCTGGAG
--L--R--G--Q--E--D--L--K--E--Q--L--A--M--V--E--R--R--A--N--L--L--Q--A--E--I--E--E--L--R--A--T--L--E-

-----------------------------------------------------------------------------><---------------------
-Q--T--E--R--S--R--K--I--A--E--Q--E--L--L--D--A--S--E--R--V--Q--L--L--H--T--Q--N--T--S--L--I--N--T--
CAGACAGAGAGGAGCAGAAAAATCGCAGAACAGGAGCTCCTGGATGCCAGTGAGCGTGTTCAGCTACTGCACACCCAGAACACCAGCCTGATCAACACCA
::::::::::::::.::.:::.:::::::::::::::::::::::::::::::::::::.::::: :::::::::::::::: :::::::::::::::::
CAGACAGAGAGGAGTAGGAAAGTCGCAGAACAGGAGCTCCTGGATGCCAGTGAGCGTGTCCAGCTCCTGCACACCCAGAACAGCAGCCTGATCAACACCA
-Q--T--E--R--S--R--K--V--A--E--Q--E--L--L--D--A--S--E--R--V--Q--L--L--H--T--Q--N--S--S--L--I--N--T--

----------------------------------------------------------------------------------------------------
K--K--K--L--E--T--D--I--S--Q--M--Q--G--E--M--E--D--I--L--Q--E--A--R--N--A--E--E--K--A--K--K--A--I--T
AGAAGAAGCTGGAGACAGATATTTCCCAAATGCAAGGAGAGATGGAGGACATTCTCCAGGAAGCCCGCAATGCAGAAGAAAAGGCCAAGAAGGCCATCAC
:::::::::::::::::::.::.:::::::::::::::::.:::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::
AGAAGAAGCTGGAGACAGACATCTCCCAAATGCAAGGAGAAATGGAGGACATTCTCCAGGAAGCTCGCAACGCAGAAGAAAAGGCCAAGAAGGCCATCAC
K--K--K--L--E--T--D--I--S--Q--M--Q--G--E--M--E--D--I--L--Q--E--A--R--N--A--E--E--K--A--K--K--A--I--T

---><-----------------------------------------------------------------------------------------------
--D--A--A--M--M--A--E--E--L--K--K--E--Q--D--T--S--A--H--L--E--R--M--K--K--N--M--E--Q--T--V--K--D--L-
TGATGCCGCCATGATGGCTGAGGAGCTGAAGAAGGAGCAGGACACCAGCGCCCACCTGGAGCGGATGAAGAAGAACATGGAGCAGACCGTGAAGGATCTG
:::::: :::::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::.::::: ::.:::::.::.
TGATGCGGCCATGATGGCCGAGGAGCTGAAGAAGGAGCAGGACACCAGTGCCCACCTGGAGCGGATGAAGAAGAATATGGAACAGACGGTAAAGGACCTA
--D--A--A--M--M--A--E--E--L--K--K--E--Q--D--T--S--A--H--L--E--R--M--K--K--N--M--E--Q--T--V--K--D--L-

--------------------------------------------------------------------------><------------------------
-Q--L--R--L--D--E--A--E--Q--L--A--L--K--G--G--K--K--Q--I--Q--K--L--E--A--R--V--R--E--L--E--G--E--V--
CAGCTCCGTCTGGATGAGGCTGAGCAGCTGGCCCTGAAGGGTGGGAAGAAGCAGATCCAGAAACTGGAGGCCAGGGTACGGGAGCTGGAAGGAGAGGTTG
:::: ::::::::::::::::::::::::::::::::::::.::::::::::::::::::::.::::::::::::::.:: ::.::::::::::::::::
CAGCACCGTCTGGATGAGGCTGAGCAGCTGGCCCTGAAGGGCGGGAAGAAGCAGATCCAGAAGCTGGAGGCCAGGGTGCGTGAACTGGAAGGAGAGGTTG
-Q--H--R--L--D--E--A--E--Q--L--A--L--K--G--G--K--K--Q--I--Q--K--L--E--A--R--V--R--E--L--E--G--E--V--

-------------------------------------------------------------------------------><-------------------
E--S--E--Q--K--R--N--A--E--A--V--K--G--L--R--K--H--E--R--R--V--K--E--L--T--Y--Q--T--E--E--D--R--K--N
AGAGTGAGCAAAAGCGTAATGCTGAGGCTGTCAAAGGTCTGCGCAAACATGAGAGGCGAGTGAAGGAACTCACTTACCAGACGGAAGAAGATAGAAAGAA
:::::::::::::::::::::::::.::::::::.::.:::::::::::::::::: ::::::::::::::::.::::::::::::::.::: :.::.::
AGAGTGAGCAAAAGCGTAATGCTGAAGCTGTCAAGGGCCTGCGCAAACATGAGAGGAGAGTGAAGGAACTCACCTACCAGACGGAAGAGGATCGGAAAAA
E--S--E--Q--K--R--N--A--E--A--V--K--G--L--R--K--H--E--R--R--V--K--E--L--T--Y--Q--T--E--E--D--R--K--N

---------------------------------------------------------------------------><-----------------------
--I--L--R--L--Q--D--L--V--D--K--L--Q--A--K--V--K--S--Y--K--R--Q--A--E--E--A--E--E--Q--S--N--T--N--L-
TATTCTCAGGCTTCAAGATTTGGTAGATAAACTTCAGGCAAAAGTGAAATCTTATAAGAGACAAGCTGAGGAGGCTGAGGAACAATCCAACACCAATCTA
:::::::::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.:: ::::::
TATTCTCAGGCTTCAGGATTTGGTAGATAAACTTCAGGCAAAAGTGAAATCTTACAAGAGACAAGCTGAGGAGGCTGAGGAACAATCCAATACAAATCTA
--I--L--R--L--Q--D--L--V--D--K--L--Q--A--K--V--K--S--Y--K--R--Q--A--E--E--A--E--E--Q--S--N--T--N--L-

----------------------------------------------------------------------------------------------------
-A--K--F--R--K--L--Q--H--E--L--E--E--A--E--E--R--A--D--I--A--E--S--Q--V--N--K--L--R--V--K--S--R--E--
GCTAAATTCCGCAAGCTCCAGCATGAGCTGGAGGAGGCCGAGGAACGGGCTGACATTGCTGAGTCCCAGGTGAACAAACTGCGGGTGAAGAGCCGGGAGG
 ::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.::::::::::: :::::.::::::::::::::::::::::
TCTAAATTCCGCAAGCTCCAGCACGAGCTGGAGGAGGCCGAGGAACGGGCTGACATTGCCGAGTCCCAGGTCAACAAGCTGCGGGTGAAGAGCCGGGAGG
-S--K--F--R--K--L--Q--H--E--L--E--E--A--E--E--R--A--D--I--A--E--S--Q--V--N--K--L--R--V--K--S--R--E--

---------------------------->
V--H--T--K--V--I--S--E--E--*-
TTCACACAAAAGTCATAAGTGAAGAGTGA
:::::::::::::::::::::::::.:::
TTCACACAAAAGTCATAAGTGAAGAATGA
V--H--T--K--V--I--S--E--E--*-

Pig Consensus Sequence

>BGISUST0000899520
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------GGGACTCTGGAAGATCAGATCATCAGTGCCAACCCGCTGCTGGAGGCCTTTG
GCAACGCCAAGACCGTGAGGAATGACAACTCCTCTCGCTTTGGTAAATTCATTAGAATCCACTTTGGCACTACAGGAAAACTGGCTTCTGCTGATATTGA
AACA---CTGTTAGAGAAGTCTAGGGTTACTTTCCAGCTTAAGGCTGAAAGGAGCTATCACATTTTTTATCAGATCACATCAAACAGGAAACCAGAACTC
ATT---ATGCTTCTGATCACCACCAACCCATATGATTACCCATTCATCAGTCAAGGGGAGATCAGTGTAGCCAGCATTGATGATCAGGAAGAACTGATAG
CCACAGAT------------------GGCTTTACTAATGAAGAGAAGGTCTCCATTTACAAGCTCACGGGAGCTGTGATGCATTATGGAAACTTAAAATT
CAAGCAAAAACAGCGTGAAGAGCAAGCAGAGCCAGACGGCACGGAA---GCTGACAAGGCAGCCTACCTTCAGAGTCTGAACTCTGCTGACCTGCTCAAA
GCCCTCTGCTACCCCAGGGTtaAGGTCGGCAATGAATATGTCACCAAAGGCCAGACAGTAGAGCAGGTGACCAATGCAGTGGGTGCTCTGGCCAAAGCCG
TCTACGAGAAGATGTTCCTGTGGATGGTCACTCGCATCAACCAGCAGCTGGACACCAAGCAGCCCAGGCAGTACTTCATCGGGGTCTTGGACATCGCCGG
CTTTGAGATCTTTGATTTTAACAGCCTGGAGCAGCTGTGCATCAACTTCACCAATGAGAAACTGCAACAGTTTTTCAACCACCACATGTTCGTGCTGGAG
CAGGAGGAGTATAAGAGGGAAGGCATCGAGTGGACGTCCATTGACTTAGGGATGGACCTGGCCGCCTGCATCGAGCTCATCGAGAAG-------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------------GAA
GCTGAAGGCTTGGCTGATGCAGAGGAAAGATGTGACCAGCTGATCAAAACCAAAATCCAGCTGGAGGCCAAAATCAAGGAGGTGACTGAGAGAGCTGAGG
ATGAGGAAGAGATCAATGCCGAGCTGACGGCCAAGAAGAGGAAACTGGAGGATGAGTGCTCAGAACTGAAGAAAGACATCGATGACCTTGAGCTGACACT
GGCCAAGGTTGAAAAGGAGAAACATGCCACAGAGAACAAGGTGAAAAACCTCACGGAAGAGATGGCAGGCCTGGACGAAACCATTGCAAAGCTGACCAAG
GAGAAGAAGGCCCTCCAGGAGGCCCACCAGCAGACCCTGGATGACCTGCAGGCAGAAGAGGACAAAGTCAACACCCTGAACAAAGCTAAAGCCAAGCTAG
AGCAGCAAGTGGATGATCTTGAAGGGTCCTTGGAGCAAGAAAAGAAACTTCGCATGGACTTAGAGAGAGCCAAGAGGAAACTGGAAGGTGACCTCAAGTT
GGCTCAAGAGTCCATAATGGACATTGAGAATGAAAAACAGCAACTTGATGAAAAGCTTAAA---AAAGAGTTTGAAATAAGCAATTTACAAAGCAAGATT
GAAGATGAACAAGCACTTGCCATTCAGCTGCAAAAGAAGATCAAAGAGTTGCAAGCCCGCATTGAGGAGCTTGAAGAGGAGATCGAGGCAGAGCGGGCCT
CCAGGGCCAAAGCAGAGAAGCAGCGCTCCGACCTCTCCCGGGAACTGGAGGAGATCAGCGAGAGGCTGGAAGAAGCCGGCGGGGCGACGTCAGCCCAGAT
TGAGATGAACAAGAAGCGCGAGGCTGAGTTCCAGAAGATGCGCCGGGACCTGGAGGAGGCCACCCTGCAGCATGAGGCCACAGCGGCCGCGTTGAGGAAG
AAGCACGCGGACAGCGTGGCTGAGCTGGGGGAGCAGATCGACAACCTGCAGAGGGTCAAGCAGAAGCTGGAGAAGGAGAAGAGTGAGATGAAGATGGAGA
TCGACGACCTTGCTAGCAACATGGAGACCGTCTCCAAAGCCAAGGGAAACCTAGAGAAGATGTGCCGCACTCTGGAGGACCAGCTGAGCGAGCTGAAATC
CAAGGAGGAAGAGCAGCAGCGGCTGATCAACGACCTGACGGCTCAGAGGGGACGTCTGCAGACAGAATCT---GAATTTTCACGTCAGCTAGATGAAAAA
GAAGCTCTGGTGTCTCAGTTATCAAGGGGCAAACAAGCATATACTCAACAGATTGAGGAATTAAAGAGGCAACTTGAGGAGGAGATA---GCCAAGAATG
CCCTGGCGCACGCTCTGCAGTCCTCCCGCCACGACTGCGACCTGCTGCGGGAACAGTATGAGGAGGAGCAGGAATCCAAGGCCGAGCTGCAGAGGGCGCT
GTCCAAGGCCAACACAGAGGTTGCCCAGTGGAGGACCAAGTACGAGACGGACGCCATCCAGCGCACCGAGGAGCTGGAGGAGGCC---AAGAAACTGGCC
CAGAGGCTGCAGGCAGCTGAGGAACACGTGGAAGCTGTGAACGCCAAGTGTGCTTCCCTCGAGAAGACGAAGCAGCGGCTCCAGAATGAGGTCGAGGACC
TCATGCTCGATGTGGAGAGGACCAACGCTGCCTGCGCAGCCCTTGACAAAAAGCAAAGGAACTTCGATAAGATCCTGGCAGAGTGGAAACAGAAGTATGA
GGAAACCCACGCGGAGCTTGAAGCCTCCCAGAAGGAGGCCCGCTCTCTCGGCACTGAGCTGTTCAAGATGAAGAATGCCTATGAGGAGTCCCTTGATCAG
CTAGAAACTTTGAAACGAGAGAACAAAAACTTGCAG---GAGATTTCTGACCTCACGGAGCAGATTGCAGAAGGAGGGAAACGTATCCATGAACTGGAGA
AAATAAAGAAACAAGTGGAACAAGAAAAGTCTGAGATTCAGGCTGCTTTAGAGGAAGCAGAGGCATCTCTTGAACACGAAGAAGGAAAGATTCTGCGCAT
CCAGCTGGAGTTGAACCAAGTCAAGTCGGAGGTGGACAGGAAAATCGCTGAGAAGGATGAGGAAATCGACCAGCTGAAGAGGAACCACGTCAGAGTCGTG
GAGTCCATGCAGAGCATGCTGGATGCTGAGATCCGGAGCAGAAACGATGCCATCAGGCTCAAGAAGAAGATGGAGGGAGACCTCAATGAAATGGAAATCC
AGCTGAACCACGCCAACCGCATGGCTGCCGAGGCCCTGAGGAACTACAGGAACACCCAAGGCATCCTCAAGGACACCCAGATCCACCTGGATGACGCTCT
CAGGGGCCAAGAGGACCTGAAGGAGCAGCTGGCCATGGTGGAGCGCAGAGCCAACCTGCTGCAGGCTGAGATTGAGGAGCTGCGGGCCACGCTGGAGCAG
ACAGAGAGGAGTAGGAAAGTCGCAGAACAGGAGCTCCTGGATGCCAGTGAGCGTGTCCAGCTCCTGCACACCCAGAACAGCAGCCTGATCAACACCAAGA
AGAAGCTGGAGACAGACATCTCCCAAATGCAAGGAGAAATGGAGGACATTCTCCAGGAAGCTCGCAACGCAGAAGAAAAGGCCAAGAAGGCCATCACTGA
TGCGGCCATGATGGCCGAGGAGCTGAAGAAGGAGCAGGACACCAGTGCCCACCTGGAGCGGATGAAGAAGAATATGGAACAGACGGTAAAGGACCTACAG
CACCGTCTGGATGAGGCTGAGCAGCTGGCCCTGAAGGGCGGGAAGAAGCAGATCCAGAAGCTGGAGGCCAGGGTGCGTGAACTGGAAGGAGAGGTTGAGA
GTGAGCAAAAGCGTAATGCTGAAGCTGTCAAGGGCCTGCGCAAACATGAGAGGAGAGTGAAGGAACTCACCTACCAGACGGAAGAGGATCGGAAAAATAT
TCTCAGGCTTCAGGATTTGGTAGATAAACTTCAGGCAAAAGTGAAATCTTACAAGAGACAAGCTGAGGAGGCTGAGGAACAATCCAATACAAATCTATCT
AAATTCCGCAAGCTCCAGCACGAGCTGGAGGAGGCCGAGGAACGGGCTGACATTGCCGAGTCCCAGGTCAACAAGCTGCGGGTGAAGAGCCGGGAGGTTC
ACACAAAAGTCATAAGTGAAGAATGA


>BGISUSP0000899520
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------GTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIET-LLEKSRVTFQLKAERSYHIFYQITSNRKPEL
I-MLLITTNPYDYPFISQGEISVASIDDQEELIATD------GFTNEEKVSIYKLTGAVMHYGNLKFKQKQREEQAEPDGTE-ADKAAYLQSLNSADLLK
ALCYPRVKVGNEYVTKGQTVEQVTNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLE
QEEYKREGIEWTSIDLGMDLAACIELIEK-----------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------------------E
AEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTK
EKKALQEAHQQTLDDLQAEEDKVNTLNKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLK-KEFEISNLQSKI
EDEQALAIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRK
KHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVSKAKGNLEKMCRTLEDQLSELKSKEEEQQRLINDLTAQRGRLQTES-EFSRQLDEK
EALVSQLSRGKQAYTQQIEELKRQLEEEI-AKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEA-KKLA
QRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKYEETHAELEASQKEARSLGTELFKMKNAYEESLDQ
LETLKRENKNLQ-EISDLTEQIAEGGKRIHELEKIKKQVEQEKSEIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHVRVV
ESMQSMLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRGQEDLKEQLAMVERRANLLQAEIEELRATLEQ
TERSRKVAEQELLDASERVQLLHTQNSSLINTKKKLETDISQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQ
HRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLS
KFRKLQHELEEAEERADIAESQVNKLRVKSREVHTKVISEE*