Sequences
EST Library Info
ese1Foetus 50 days, M. semitendinosus
Clusters
Oligos
SNPs

Gene ID ENSG00000125954 (click for geneview)
Transcript ID ENST00000246166(link to ensembl)
Symbol FNTB
Localtion Chromosome:14:64523260:64599122:1 band: 14q23.3
Description Protein farnesyltransferase beta subunit (EC 2.5.1.58) (CAAX farnesyltransferase beta subunit) (RAS proteins prenyltransferase beta) (FTase-beta). [Source:Uniprot/SWISSPROT;Acc:P49356]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--S--P--S--S--F--T--Y--Y--C--P--P--S--S--S--P--V--W--S--E--P--L--Y--S--L--R--P--E--H--A--R--E--
ATGGCTTCTCCGAGTTCTTTCACCTACTATTGCCCTCCATCTTCCTCCCCCGTCTGGTCAGAGCCGCTGTACAGTCTGAGGCCCGAGCACGCGCGAGAGC
:::::::::::::::::.::::::::::::::::::::::::::::::::.:: ::: :::::::::::::::::::::::::::::::::::::.::::
ATGGCTTCTCCGAGTTCCTTCACCTACTATTGCCCTCCATCTTCCTCCCCTGTGTGGGCAGAGCCGCTGTACAGTCTGAGGCCCGAGCACGCGCGGGAGC
-M--A--S--P--S--S--F--T--Y--Y--C--P--P--S--S--S--P--V--W--A--E--P--L--Y--S--L--R--P--E--H--A--R--E--

-------------------------------------------><-------------------------------------------------------
R--L--Q--D--D--S--V--E--T--V--T--S--I--E--Q--A--K--V--E--E--K--I--Q--E--V--F--S--S--Y--K--F--N--H--L
GGTTGCAGGACGACTCGGTGGAAACAGTCACGTCCATAGAACAGGCAAAAGTAGAAGAAAAGATCCAAGAGGTCTTCAGTTCTTACAAGTTCAACCACCT
::::::::::::::::.:::::::::::::::::::: :::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::
GGTTGCAGGACGACTCAGTGGAAACAGTCACGTCCATTGAACAGGCAAAAGTAGAAGAAAAAATCCAAGAGGTCTTCAGTTCTTACAAGTTCAACCACCT
R--L--Q--D--D--S--V--E--T--V--T--S--I--E--Q--A--K--V--E--E--K--I--Q--E--V--F--S--S--Y--K--F--N--H--L

--------><-----------------------------------------------------------------------><-----------------
--V--P--R--L--V--L--Q--R--E--K--H--F--H--Y--L--K--R--G--L--R--Q--L--T--D--A--Y--E--C--L--D--A--S--R-
TGTACCAAGGCTTGTTTTGCAGAGGGAGAAGCACTTCCATTATCTGAAAAGAGGCCTTCGACAACTGACAGATGCCTATGAGTGTCTGGATGCCAGCCGC
:::::::   :::.:::::::::::::::::::::::::::::::::::::::::::.::::: :::::::::::::::::::::::.::::::::::::
TGTACCA---CTTATTTTGCAGAGGGAGAAGCACTTCCATTATCTGAAAAGAGGCCTCCGACACCTGACAGATGCCTATGAGTGTCTAGATGCCAGCCGC
--V--P-----L--I--L--Q--R--E--K--H--F--H--Y--L--K--R--G--L--R--H--L--T--D--A--Y--E--C--L--D--A--S--R-

-------------------------------------------------------------------------><-------------------------
-P--W--L--C--Y--W--I--L--H--S--L--E--L--L--D--E--P--I--P--Q--I--V--A--T--D--V--C--Q--F--L--E--L--C--
CCATGGCTCTGCTATTGGATCCTGCACAGCTTGGAACTGCTAGATGAACCCATCCCCCAGATAGTGGCTACAGATGTGTGTCAGTTCCTGGAGCTGTGTC
::::::::::::::::::::::::::::::.:::::::.::.::::::::::::::::::::.:::::.:::   :::::::::::::::::::::::::
CCATGGCTCTGCTATTGGATCCTGCACAGCCTGGAACTACTGGATGAACCCATCCCCCAGATGGTGGCCACA---GTGTGTCAGTTCCTGGAGCTGTGTC
-P--W--L--C--Y--W--I--L--H--S--L--E--L--L--D--E--P--I--P--Q--M--V--A--T-----V--C--Q--F--L--E--L--C--

----------------------------------------------------------------------------------------------------
Q--S--P--E--G--G--F--G--G--G--P--G--Q--Y--P--H--L--A--P--T--Y--A--A--V--N--A--L--C--I--I--G--T--E--E
AGAGCCCAGAAGGTGGCTTTGGAGGAGGACCCGGTCAGTATCCACACCTTGCACCCACATATGCAGCAGTCAATGCATTGTGCATCATTGGCACCGAGGA
:.:::::::::::::::::::::::.:: ::.::.:::::::::::::::::::::::.::.::::::::::::::..::::::::::::::::::::::
AAAGCCCAGAAGGTGGCTTTGGAGGGGGCCCTGGCCAGTATCCACACCTTGCACCCACGTACGCAGCAGTCAATGCGCTGTGCATCATTGGCACCGAGGA
Q--S--P--E--G--G--F--G--G--G--P--G--Q--Y--P--H--L--A--P--T--Y--A--A--V--N--A--L--C--I--I--G--T--E--E

--------------------><------------------------------------------------------------------------------
--A--Y--D--I--I--N--R--E--K--L--L--Q--Y--L--Y--S--L--K--Q--P--D--G--S--F--L--M--H--V--G--G--E--V--D-
GGCCTATGACATCATTAACAGAGAGAAGCTTCTTCAGTATTTGTACTCCCTGAAGCAACCTGACGGCTCCTTTCTCATGCATGTCGGAGGTGAGGTGGAT
::::::.::..::::::::   :::::::::::.:::::::::::::: :::::::::::.::.:::::.:::::::::::.                  
GGCCTACGATGTCATTAAC---GAGAAGCTTCTCCAGTATTTGTACTCGCTGAAGCAACCCGATGGCTCTTTTCTCATGCAC------------------
--A--Y--D--V--I--N-----E--K--L--L--Q--Y--L--Y--S--L--K--Q--P--D--G--S--F--L--M--H-------------------

----><-------------------------------------------------------------------------------------><-------
-V--R--S--A--Y--C--A--A--S--V--A--S--L--T--N--I--I--T--P--D--L--F--E--G--T--A--E--W--I--A--R--C--Q--
GTGAGAAGCGCATACTGTGCTGCCTCCGTAGCCTCGCTGACCAACATCATCACTCCAGACCTCTTTGAGGGCACTGCTGAATGGATAGCAAGGTGTCAGA
      ::.:: ::.:::::::: :: :::::.:: ::::::::::::.::::::::::::: ::::::::::::::.::::::::::::   ::.::::
------AGTGCCTATTGTGCTGCATCAGTAGCTTCTCTGACCAACATCGTCACTCCAGACCTGTTTGAGGGCACTGCCGAATGGATAGCA---TGCCAGA
-------S--A--Y--C--A--A--S--V--A--S--L--T--N--I--V--T--P--D--L--F--E--G--T--A--E--W--I--A-----C--Q--

----------------------------------------------------------------------------------------------------
N--W--E--G--G--I--G--G--V--P--G--M--E--A--H--G--G--Y--T--F--C--G--L--A--A--L--V--I--L--K--R--E--R--S
ACTGGGAAGGTGGCATTGGCGGGGTACCAGGGATGGAAGCCCATGGTGGCTATACCTTCTGTGGCCTGGCCGCGCTGGTAATCCTCAAGAGGGAACGTTC
:.::::::::::: :::::::::::.:::::::::::::::::.:::::::::::.::::::::::::::.::.::::: ::::::::::.:::.:::: 
ATTGGGAAGGTGGAATTGGCGGGGTGCCAGGGATGGAAGCCCACGGTGGCTATACTTTCTGTGGCCTGGCTGCACTGGTCATCCTCAAGAAGGAGCGTTG
N--W--E--G--G--I--G--G--V--P--G--M--E--A--H--G--G--Y--T--F--C--G--L--A--A--L--V--I--L--K--K--E--R--C

---------------------><-----------------------------------------------------------------------------
--L--N--L--K--S--L--L--Q--W--V--T--S--R--Q--M--R--F--E--G--G--F--Q--G--R--C--N--K--L--V--D--G--C--Y-
CTTGAACTTGAAGAGCTTATTACAATGGGTGACAAGCCGGCAGATGCGATTTGAAGGAGGATTTCAGGGCCGCTGCAACAAGCTGGTGGATGGCTGCTAC
:::.:::::::::::::::::::::::::::::.::::::::::::::.:::::::: ::.:::::::::::::::::::::::::::::::::::::::
CTTAAACTTGAAGAGCTTATTACAATGGGTGACGAGCCGGCAGATGCGGTTTGAAGGTGGGTTTCAGGGCCGCTGCAACAAGCTGGTGGATGGCTGCTAC
--L--N--L--K--S--L--L--Q--W--V--T--S--R--Q--M--R--F--E--G--G--F--Q--G--R--C--N--K--L--V--D--G--C--Y-

------------------------------------------------------><--------------------------------------------
-S--F--W--Q--A--G--L--L--P--L--L--H--R--A--L--H--A--Q--G--D--P--A--L--S--M--S--H--W--M--F--H--Q--Q--
TCCTTCTGGCAGGCGGGGCTCCTGCCCCTGCTCCACCGCGCACTGCACGCCCAAGGTGACCCTGCCCTTAGCATGAGCCACTGGATGTTCCATCAGCAGG
::::::::::::::.::::::::::::::::::::::::::.::::::::::::                              :::::.::::::::::
TCCTTCTGGCAGGCAGGGCTCCTGCCCCTGCTCCACCGCGCGCTGCACGCCCAA------------------------------ATGTTTCATCAGCAGG
-S--F--W--Q--A--G--L--L--P--L--L--H--R--A--L--H--A--Q--------------------------------M--F--H--Q--Q--

------------------------------------------------------------------><--------------------------------
A--L--Q--E--Y--I--L--M--C--C--Q--C--P--A--G--G--L--L--D--K--P--G--K--S--R--D--F--Y--H--T--C--Y--C--L
CCCTGCAGGAGTACATCCTGATGTGCTGCCAGTGCCCTGCGGGGGGGCTTCTGGATAAACCTGGCAAGTCGCGTGATTTCTACCACACCTGCTACTGCCT
: ::::::::::::::.:: :::::::::::::::::::: ::::: :::::::::::.::::::   :: :: ::.:::::::::::::: ::::::::
CACTGCAGGAGTACATTCTCATGTGCTGCCAGTGCCCTGCCGGGGGCCTTCTGGATAAGCCTGGC---TCCCGAGACTTCTACCACACCTGATACTGCCT
A--L--Q--E--Y--I--L--M--C--C--Q--C--P--A--G--G--L--L--D--K--P--G-----S--R--D--F--Y--H--T--*--Y--C--L

---------------------------------------------------------------------------------><-----------------
--S--G--L--S--I--A--Q--H--F--G--S--G--A--M--L--H--D--V--V--L--G--V--P--E--N--A--L--Q--P--T--H--P--V-
GAGCGGCCTGTCCATAGCCCAGCACTTCGGCAGCGGAGCCATGTTGCATGATGTGGTCCTGGGTGTGCCCGAAAACGCTCTGCAGCCCACTCACCCAGTG
:::::::::::::::::::::::::::::::::::::::::::.::::.:::::::::::::::::::: ::::::::.::::::::::::::::: ::.
GAGCGGCCTGTCCATAGCCCAGCACTTCGGCAGCGGAGCCATGCTGCACGATGTGGTCCTGGGTGTGCCGGAAAACGCCCTGCAGCCCACTCACCCTGTA
--S--G--L--S--I--A--Q--H--F--G--S--G--A--M--L--H--D--V--V--L--G--V--P--E--N--A--L--Q--P--T--H--P--V-

----------------------------------------------------------------------------------------------------
-Y--N--I--G-----P--D--K--V--I--Q--A--T--T--Y--F--L--Q--K--P--V--P--G--F--E--E--L--K--D--E--T--S--A--
TACAACATTGGA---CCAGACAAGGTGATCCAGGCCACTACATACTTTCTACAGAAGCCAGTCCCAGGTTTTGAGGAGCTTAAGGATGAGACATCGGCAG
:::::.:::::.   :::::.:::::::::::.:::::.:...::::::::::::::::.::::::::.:::::::::: :.::::::::.:: :.::::
TACAATATTGGGA--CCAGATAAGGTGATCCAAGCCACCATGCACTTTCTACAGAAGCCGGTCCCAGGCTTTGAGGAGCATGAGGATGAGGCAACAGCAG
-Y--N--I--G--\--P--D--K--V--I--Q--A--T--M--H--F--L--Q--K--P--V--P--G--F--E--E--H--E--D--E--A--T--A--

---------------->
E--P--A--T--D--*-
AGCCTGCAACCGACTAG
::::::: ::.::::::
AGCCTGCCACTGACTAG
E--P--A--T--D--*-

Pig Consensus Sequence

>BGISUST0000883882
ATGGCTTCTCCGAGTTCCTTCACCTACTATTGCCCTCCATCTTCCTCCCCTGTGTGGGCAGAGCCGCTGTACAGTCTGAGGCCCGAGCACGCGCGGGAGC
GGTTGCAGGACGACTCAGTGGAAACAGTCACGTCCATTGAACAGGCAAAAGTAGAAGAAAAAATCCAAGAGGTCTTCAGTTCTTACAAGTTCAACCACCT
TGTACCA---CTTATTTTGCAGAGGGAGAAGCACTTCCATTATCTGAAAAGAGGCCTCCGACACCTGACAGATGCCTATGAGTGTCTAGATGCCAGCCGC
CCATGGCTCTGCTATTGGATCCTGCACAGCCTGGAACTACTGGATGAACCCATCCCCCAGATGGTGGCCACA---GTGTGTCAGTTCCTGGAGCTGTGTC
AAAGCCCAGAAGGTGGCTTTGGAGGGGGCCCTGGCCAGTATCCACACCTTGCACCCACGTACGCAGCAGTCAATGCGCTGTGCATCATTGGCACCGAGGA
GGCCTACGATGTCATTAAC---GAGAAGCTTCTCCAGTATTTGTACTCGCTGAAGCAACCCGATGGCTCTTTTCTCATGCAC------------------
------AGTGCCTATTGTGCTGCATCAGTAGCTTCTCTGACCAACATCGTCACTCCAGACCTGTTTGAGGGCACTGCCGAATGGATAGCA---TGCCAGA
ATTGGGAAGGTGGAATTGGCGGGGTGCCAGGGATGGAAGCCCACGGTGGCTATACTTTCTGTGGCCTGGCTGCACTGGTCATCCTCAAGAAGGAGCGTTG
CTTAAACTTGAAGAGCTTATTACAATGGGTGACGAGCCGGCAGATGCGGTTTGAAGGTGGGTTTCAGGGCCGCTGCAACAAGCTGGTGGATGGCTGCTAC
TCCTTCTGGCAGGCAGGGCTCCTGCCCCTGCTCCACCGCGCGCTGCACGCCCAA------------------------------ATGTTTCATCAGCAGG
CACTGCAGGAGTACATTCTCATGTGCTGCCAGTGCCCTGCCGGGGGCCTTCTGGATAAGCCTGGC---TCCCGAGACTTCTACCACACCTGATACTGCCT
GAGCGGCCTGTCCATAGCCCAGCACTTCGGCAGCGGAGCCATGCTGCACGATGTGGTCCTGGGTGTGCCGGAAAACGCCCTGCAGCCCACTCACCCTGTA
TACAATATTGGgcCAGATAAGGTGATCCAAGCCACCATGCACTTTCTACAGAAGCCGGTCCCAGGCTTTGAGGAGCATGAGGATGAGGCAACAGCAGAGC
CTGCCACTGACTAG


>BGISUSP0000883882
MASPSSFTYYCPPSSSPVWAEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVP-LILQREKHFHYLKRGLRHLTDAYECLDASR
PWLCYWILHSLELLDEPIPQMVAT-VCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDVIN-EKLLQYLYSLKQPDGSFLMH------
--SAYCAASVASLTNIVTPDLFEGTAEWIA-CQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERCLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY
SFWQAGLLPLLHRALHAQ----------MFHQQALQEYILMCCQCPAGGLLDKPG-SRDFYHT*YCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATMHFLQKPVPGFEEHEDEATAEPATD*