Sequences
EST Library Info
dbla1Unavailable
fat1Fatt
nco1Newborn 115 days, colon
nep1Newborn 115 days, epidermis
ova1Ovary
pgl1Pituitary gland
plac2Unavailable
ret1Retina
spc4Spinal cord
tes4Testes
thg2Thyroid gland
tra2Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000126803 (click for geneview)
Transcript ID ENST00000247207(link to ensembl)
Symbol HSPA2
Localtion Chromosome:14:64072376:64079705:1 band: 14q23.3
Description Heat shock-related 70 kDa protein 2 (Heat shock 70 kDa protein 2). [Source:Uniprot/SWISSPROT;Acc:P54652]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--A--R--G--P--A--I--G--I--D--L--G--T--T--Y--S--C--V--G--V--F--Q--H--G--K--V--E--I--I--A--N--D--
ATGTCTGCCCGTGGCCCGGCTATCGGCATCGACCTGGGCACCACCTATTCGTGCGTCGGGGTCTTCCAACATGGCAAGGTGGAGATCATCGCCAACGACC
:::::::::::.:::::::::::::::::::::::::::::.:::::.:::::::: :::::::::::::::::::::::::::::::::::::::::::
ATGTCTGCCCGCGGCCCGGCTATCGGCATCGACCTGGGCACTACCTACTCGTGCGTGGGGGTCTTCCAACATGGCAAGGTGGAGATCATCGCCAACGACC
-M--S--A--R--G--P--A--I--G--I--D--L--G--T--T--Y--S--C--V--G--V--F--Q--H--G--K--V--E--I--I--A--N--D--

----------------------------------------------------------------------------------------------------
Q--G--N--R--T--T--P--S--Y--V--A--F--T--D--T--E--R--L--I--G--D--A--A--K--N--Q--V--A--M--N--P--T--N--T
AGGGCAATCGCACCACCCCCAGCTACGTGGCCTTCACGGACACCGAGCGCCTCATCGGCGACGCCGCCAAGAACCAGGTGGCCATGAACCCCACCAACAC
:::::::.::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::
AGGGCAACCGCACCACCCCCAGCTACGTGGCCTTCACCGACACCGAGCGCCTCATCGGCGACGCCGCCAAGAACCAGGTGGCCATGAACCCCACGAACAC
Q--G--N--R--T--T--P--S--Y--V--A--F--T--D--T--E--R--L--I--G--D--A--A--K--N--Q--V--A--M--N--P--T--N--T

----------------------------------------------------------------------------------------------------
--I--F--D--A--K--R--L--I--G--R--K--F--E--D--A--T--V--Q--S--D--M--K--H--W--P--F--R--V--V--S--E--G--G-
CATCTTCGACGCCAAGAGGCTGATTGGACGGAAATTCGAGGATGCCACAGTGCAGTCGGATATGAAACACTGGCCGTTCCGGGTGGTGAGCGAGGGAGGC
::::::::::::::::::::::::.::::::::.::::::::.:::::::::::.:::::.::::::::::::::.::::::::::::::::::::::: 
CATCTTCGACGCCAAGAGGCTGATCGGACGGAAGTTCGAGGACGCCACAGTGCAATCGGACATGAAACACTGGCCATTCCGGGTGGTGAGCGAGGGAGGG
--I--F--D--A--K--R--L--I--G--R--K--F--E--D--A--T--V--Q--S--D--M--K--H--W--P--F--R--V--V--S--E--G--G-

----------------------------------------------------------------------------------------------------
-K--P--K--V--Q--V--E--Y--K--G--E--T--K--T--F--F--P--E--E--I--S--S--M--V--L--T--K--M--K--E--I--A--E--
AAGCCCAAAGTGCAAGTAGAGTACAAGGGGGAGACCAAGACCTTCTTCCCAGAGGAGATATCCTCCATGGTCCTCACGAAGATGAAGGAGATCGCGGAAG
::::::::::::::.::.:::::::::::.::::.:::::::::::::::.:::::::: ::.:::::::::::::: ::::::::::::::::: ::::
AAGCCCAAAGTGCAGGTGGAGTACAAGGGAGAGATCAAGACCTTCTTCCCGGAGGAGATCTCTTCCATGGTCCTCACTAAGATGAAGGAGATCGCCGAAG
-K--P--K--V--Q--V--E--Y--K--G--E--I--K--T--F--F--P--E--E--I--S--S--M--V--L--T--K--M--K--E--I--A--E--

----------------------------------------------------------------------------------------------------
A--Y--L--G--G--K--V--H--S--A--V--I--T--V--P--A--Y--F--N--D--S--Q--R--Q--A--T--K--D--A--G--T--I--T--G
CCTACCTGGGGGGCAAGGTGCACAGCGCGGTCATAACGGTCCCGGCCTATTTCAACGACTCGCAGCGCCAGGCCACCAAGGACGCAGGCACCATCACGGG
:::::::::::::::::::::: ::::::::::: :: ::::: :::::::::::.::::: :::::::::::::::::::::::.::::::::::::::
CCTACCTGGGGGGCAAGGTGCAGAGCGCGGTCATCACCGTCCCCGCCTATTTCAATGACTCTCAGCGCCAGGCCACCAAGGACGCGGGCACCATCACGGG
A--Y--L--G--G--K--V--Q--S--A--V--I--T--V--P--A--Y--F--N--D--S--Q--R--Q--A--T--K--D--A--G--T--I--T--G

----------------------------------------------------------------------------------------------------
--L--N--V--L--R--I--I--N--E--P--T--A--A--A--I--A--Y--G--L--D--K--K--G--C--A--G--G-----E--K--N--V--L-
GCTCAATGTGCTGCGCATCATCAACGAGCCCACGGCGGCGGCCATCGCCTACGGCCTGGACAAGAAGGGCTGCGCGGGCGGC---GAGAAGAACGTGCTC
 ::.::::::::::::::::::::::::::.::.:::::.:::::::::::::::::::::::::::::::::::::::::    :::::::::::::::
CCTTAATGTGCTGCGCATCATCAACGAGCCTACAGCGGCAGCCATCGCCTACGGCCTGGACAAGAAGGGCTGCGCGGGCGGGC--GAGAAGAACGTGCTC
--L--N--V--L--R--I--I--N--E--P--T--A--A--A--I--A--Y--G--L--D--K--K--G--C--A--G--G--\--E--K--N--V--L-

----------------------------------------------------------------------------------------------------
-I--F--D--L--G--G--G--T--F--D--V--S--I--L--T--I--E--D--G--I--F--E--V--K--S--T--A--G--D--T--H--L--G--
ATCTTTGACCTGGGCGGTGGCACTTTCGACGTGTCCATCCTGACCATCGAGGATGGCATCTTCGAGGTGAAGTCCACGGCCGGCGACACCCACCTGGGCG
::.::.:::::::::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::
ATTTTCGACCTGGGCGGCGGCACTTTCGACGTGTCCATCCTGACCATCGAGGACGGCATCTTCGAGGTGAAGTCCACGGCTGGCGACACCCACCTGGGCG
-I--F--D--L--G--G--G--T--F--D--V--S--I--L--T--I--E--D--G--I--F--E--V--K--S--T--A--G--D--T--H--L--G--

----------------------------------------------------------------------------------------------------
G--E--D--F--D--N--R--M--V--S--H--L--A--E--E--F--K--R--K--H--K--K--D--I--G--P--N--K--R--A--V--R--R--L
GTGAGGACTTCGACAACCGCATGGTGAGCCACCTGGCGGAGGAGTTCAAGCGCAAGCACAAGAAGGACATTGGGCCCAACAAGCGCGCCGTGAGGCGGCT
:.:::::::::::.::::::::::::::::::.:::: :::::::::::.:::::::::::::::::::::::::::::::::::::: ::: ::::.::
GCGAGGACTTCGATAACCGCATGGTGAGCCACTTGGCCGAGGAGTTCAAACGCAAGCACAAGAAGGACATTGGGCCCAACAAGCGCGCGGTGCGGCGACT
G--E--D--F--D--N--R--M--V--S--H--L--A--E--E--F--K--R--K--H--K--K--D--I--G--P--N--K--R--A--V--R--R--L

----------------------------------------------------------------------------------------------------
--R--T--A--C--E--R--A--K--R--T--L--S--S--S--T--Q--A--S--I--E--I--D--S--L--Y--E--G--V--D--F--Y--T--S-
GCGCACCGCTTGCGAGCGCGCCAAGCGCACCCTGAGCTCGTCCACGCAGGCGAGCATCGAGATCGACTCGCTCTACGAGGGCGTGGACTTCTATACGTCC
 ::::::::.:::::::::::.:::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.::::::
CCGCACCGCCTGCGAGCGCGCTAAGCGCACCCTGAGCTCGTCCACACAGGCGAGCATCGAGATCGACTCGCTCTACGAGGGCGTGGACTTCTACACGTCC
--R--T--A--C--E--R--A--K--R--T--L--S--S--S--T--Q--A--S--I--E--I--D--S--L--Y--E--G--V--D--F--Y--T--S-

----------------------------------------------------------------------------------------------------
-I--T--R--A--R--F--E--E--L--N--A--D--L--F--R--G--T--L--E--P--V--E--K--A--L--R--D--A--K--L--D--K--G--
ATCACGCGCGCCCGCTTCGAGGAGCTCAATGCCGACCTCTTTCGCGGGACCCTGGAGCCGGTGGAGAAGGCGCTGCGCGACGCCAAGCTGGACAAGGGCC
::::: :: ::::::::.:::::::::::.:: ::::: :::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::
ATCACCCGGGCCCGCTTTGAGGAGCTCAACGCAGACCTGTTTCGCGGGACCCTCGAGCCGGTGGAGAAGGCGCTGCGCGACGCCAAGCTGGACAAGGGCC
-I--T--R--A--R--F--E--E--L--N--A--D--L--F--R--G--T--L--E--P--V--E--K--A--L--R--D--A--K--L--D--K--G--

----------------------------------------------------------------------------------------------------
Q--I--Q--E--I--V--L--V--G--G--S--T--R--I--P--K--I--Q--K--L--L--Q--D--F--F--N--G--K--E--L--N--K--S--I
AGATCCAGGAGATCGTGCTGGTGGGCGGCTCCACTCGTATCCCCAAGATCCAGAAGCTGCTGCAGGATTTCTTCAACGGCAAGGAGCTGAACAAGAGCAT
: ::::: :::::::::::::::::::::::::::::.:::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::
ATATCCATGAGATCGTGCTGGTGGGCGGCTCCACTCGCATCCCCAAGATCCATAAGCTGCTGCAGGATTTCTTCAACGGCAAGGAGCTGAACAAGAGCAT
H--I--H--E--I--V--L--V--G--G--S--T--R--I--P--K--I--H--K--L--L--Q--D--F--F--N--G--K--E--L--N--K--S--I

----------------------------------------------------------------------------------------------------
--N--P--D--E--A--V--A--Y--G--A--A--V--Q--A--A--I--L--I--G--D--K--S--E--N--V--Q--D--L--L--L--L--D--V-
CAACCCCGACGAGGCGGTGGCCTATGGCGCCGCGGTGCAGGCGGCCATCCTCATCGGCGACAAATCAGAGAATGTGCAGGACCTGCTGCTACTCGACGTG
::::::.:::::::::::::::::.:: ::::: ::::::::.:: ::::: ::::: :::::.:: :::::.:::::::::::::::::::::::::::
CAACCCTGACGAGGCGGTGGCCTACGGAGCCGCTGTGCAGGCAGCGATCCTGATCGGGGACAAGTCCGAGAACGTGCAGGACCTGCTGCTACTCGACGTG
--N--P--D--E--A--V--A--Y--G--A--A--V--Q--A--A--I--L--I--G--D--K--S--E--N--V--Q--D--L--L--L--L--D--V-

----------------------------------------------------------------------------------------------------
-T--P--L--S--L--G--I--E--T--A--G--G--V--M--T--P--L--I--K--R--N--T--T--I--P--T--K--Q--T--Q--T--F--T--
ACCCCGTTGTCGCTGGGCATCGAGACAGCTGGCGGTGTCATGACCCCACTCATCAAGAGGAACACCACGATCCCCACCAAGCAGACGCAGACCTTCACCA
::::::.: :::::::::::::::::.::::::::.::::::::.:::::::::::.:::::::::::::::::::: ::::::::::::::::::::::
ACCCCGCTCTCGCTGGGCATCGAGACGGCTGGCGGCGTCATGACTCCACTCATCAAAAGGAACACCACGATCCCCACGAAGCAGACGCAGACCTTCACCA
-T--P--L--S--L--G--I--E--T--A--G--G--V--M--T--P--L--I--K--R--N--T--T--I--P--T--K--Q--T--Q--T--F--T--

----------------------------------------------------------------------------------------------------
T--Y--S--D--N--Q--S--S--V--L--V--Q--V--Y--E--G--E--R--A--M--T--K--D--N--N--L--L--G--K--F--D--L--T--G
CCTACTCGGACAACCAGAGCAGCGTACTGGTGCAGGTATACGAGGGCGAACGGGCCATGACCAAGGACAATAACCTGCTGGGCAAGTTCGACCTGACCGG
:::::::.:::::::::::::::::.:::::::::::.::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::
CCTACTCAGACAACCAGAGCAGCGTGCTGGTGCAGGTGTACGAGGGCGAACGGGCCATGACAAAGGACAATAACCTGCTGGGCAAGTTCGACCTGACCGG
T--Y--S--D--N--Q--S--S--V--L--V--Q--V--Y--E--G--E--R--A--M--T--K--D--N--N--L--L--G--K--F--D--L--T--G

----------------------------------------------------------------------------------------------------
--I--P--P--A--P--R--G--V--P--Q--I--E--V--T--F--D--I--D--A--N--G--I--L--N--V--T--A--A--D--K--S--T--G-
GATTCCCCCTGCGCCTCGCGGGGTCCCCCAAATCGAGGTTACCTTCGACATTGACGCCAATGGCATCCTTAACGTTACCGCCGCCGACAAGAGCACCGGT
::::::::: :::::.::::::::::::::.::.:::::.:::::::::::.::.::::::::::::::.:::::.::::::::::::::::::::::::
GATTCCCCCGGCGCCCCGCGGGGTCCCCCAGATTGAGGTCACCTTCGACATCGATGCCAATGGCATCCTCAACGTCACCGCCGCCGACAAGAGCACCGGT
--I--P--P--A--P--R--G--V--P--Q--I--E--V--T--F--D--I--D--A--N--G--I--L--N--V--T--A--A--D--K--S--T--G-

----------------------------------------------------------------------------------------------------
-K--E--N--K--I--T--I--T--N--D--K--G--R--L--S--K--D--D--I--D--R--M--V--Q--E--A--E--R--Y--K--S--E--D--
AAGGAAAACAAAATCACCATCACCAATGACAAAGGTCGTCTGAGCAAGGACGACATTGACCGGATGGTGCAGGAGGCGGAGCGGTACAAATCGGAAGATG
::.:::::::::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::::::::::: :::::::::::.::::::::::
AAAGAAAACAAAATCACCATCACCAACGACAAAGGTCGTCTAAGCAAGGACGACATTGACCGGATGGTGCAGGAGGCTGAGCGGTACAAGTCGGAAGATG
-K--E--N--K--I--T--I--T--N--D--K--G--R--L--S--K--D--D--I--D--R--M--V--Q--E--A--E--R--Y--K--S--E--D--

----------------------------------------------------------------------------------------------------
E--A--N--R--D--R--V--A--A--K--N--A--L--E--S--Y--T--Y--N--I--K--Q--T--V--E--D--E--K--L--R--G--K--I--S
AGGCGAATCGCGACCGAGTCGCGGCCAAAAACGCCCTGGAGTCCTATACCTACAACATCAAGCAGACGGTGGAAGACGAGAAACTGAGGGGCAAGATTAG
:::: :::::::::::.:: :: :::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AGGCCAATCGCGACCGGGTAGCCGCCAAAAACGCCGTGGAGTCCTATACCTACAACATCAAGCAGACGGTGGAAGACGAGAAACTGAGGGGCAAGATTAG
E--A--N--R--D--R--V--A--A--K--N--A--V--E--S--Y--T--Y--N--I--K--Q--T--V--E--D--E--K--L--R--G--K--I--S

----------------------------------------------------------------------------------------------------
--E--Q--D--K--N--K--I--L--D--K--C--Q--E--V--I--N--W--L--D--R--N--Q--M--A--E--K--D--E--Y--E--H--K--Q-
CGAGCAGGACAAAAACAAGATCCTCGACAAGTGTCAGGAGGTGATCAACTGGCTCGACCGAAACCAGATGGCAGAGAAAGATGAGTATGAACACAAGCAG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::
CGAGCAGGACAAAAACAAGATCCTCGACAAGTGTCAGGAGGTGATCAACTGGCTCGACCGAAACCAGATGGCGGAGAAAGATGAGTATGAACACAAGCAG
--E--Q--D--K--N--K--I--L--D--K--C--Q--E--V--I--N--W--L--D--R--N--Q--M--A--E--K--D--E--Y--E--H--K--Q-

----------------------------------------------------------------------------------------------------
-K--E--L--E--R--V--C--N--P--I--I--S--K--L--Y--Q--G--G--P--G--G--G--S--G--G--G--G--S--G--A--S--G--G--
AAAGAGCTCGAAAGAGTTTGCAACCCCATCATCAGCAAACTTTACCAAGGTGGTCCTGGCGGCGGCAGCGGCGGCGGCGGTTCAGGAGCCTCCGGGGGAC
::::::::::::::::: ::::::::::::::::::::::::::::::::.::.::::::         ::.::::::::: : ::::::::::::::::
AAAGAGCTCGAAAGAGTGTGCAACCCCATCATCAGCAAACTTTACCAAGGCGGCCCTGGC---------GGTGGCGGCGGTACTGGAGCCTCCGGGGGAC
-K--E--L--E--R--V--C--N--P--I--I--S--K--L--Y--Q--G--G--P--G-----------G--G--G--G--T--G--A--S--G--G--

---------------------->
P--T--I--E--E--V--D--*-
CCACCATCGAAGAAGTGGACTAA
: ::::::::.:::::::::   
CGACCATCGAGGAAGTGGAC---
P--T--I--E--E--V--D----

Pig Consensus Sequence

>BGISUST0000877915
ATGTCTGCCCGCGGCCCGGCTATCGGCATCGACCTGGGCACTACCTACTCGTGCGTGGGGGTCTTCCAACATGGCAAGGTGGAGATCATCGCCAACGACC
AGGGCAACCGCACCACCCCCAGCTACGTGGCCTTCACCGACACCGAGCGCCTCATCGGCGACGCCGCCAAGAACCAGGTGGCCATGAACCCCACGAACAC
CATCTTCGACGCCAAGAGGCTGATCGGACGGAAGTTCGAGGACGCCACAGTGCAATCGGACATGAAACACTGGCCATTCCGGGTGGTGAGCGAGGGAGGG
AAGCCCAAAGTGCAGGTGGAGTACAAGGGAGAGATCAAGACCTTCTTCCCGGAGGAGATCTCTTCCATGGTCCTCACTAAGATGAAGGAGATCGCCGAAG
CCTACCTGGGGGGCAAGGTGCAGAGCGCGGTCATCACCGTCCCCGCCTATTTCAATGACTCTCAGCGCCAGGCCACCAAGGACGCGGGCACCATCACGGG
CCTTAATGTGCTGCGCATCATCAACGAGCCTACAGCGGCAGCCATCGCCTACGGCCTGGACAAGAAGGGCTGCGCGGGCGGggAGAAGAACGTGCTCATT
TTCGACCTGGGCGGCGGCACTTTCGACGTGTCCATCCTGACCATCGAGGACGGCATCTTCGAGGTGAAGTCCACGGCTGGCGACACCCACCTGGGCGGCG
AGGACTTCGATAACCGCATGGTGAGCCACTTGGCCGAGGAGTTCAAACGCAAGCACAAGAAGGACATTGGGCCCAACAAGCGCGCGGTGCGGCGACTCCG
CACCGCCTGCGAGCGCGCTAAGCGCACCCTGAGCTCGTCCACACAGGCGAGCATCGAGATCGACTCGCTCTACGAGGGCGTGGACTTCTACACGTCCATC
ACCCGGGCCCGCTTTGAGGAGCTCAACGCAGACCTGTTTCGCGGGACCCTCGAGCCGGTGGAGAAGGCGCTGCGCGACGCCAAGCTGGACAAGGGCCATA
TCCATGAGATCGTGCTGGTGGGCGGCTCCACTCGCATCCCCAAGATCCATAAGCTGCTGCAGGATTTCTTCAACGGCAAGGAGCTGAACAAGAGCATCAA
CCCTGACGAGGCGGTGGCCTACGGAGCCGCTGTGCAGGCAGCGATCCTGATCGGGGACAAGTCCGAGAACGTGCAGGACCTGCTGCTACTCGACGTGACC
CCGCTCTCGCTGGGCATCGAGACGGCTGGCGGCGTCATGACTCCACTCATCAAAAGGAACACCACGATCCCCACGAAGCAGACGCAGACCTTCACCACCT
ACTCAGACAACCAGAGCAGCGTGCTGGTGCAGGTGTACGAGGGCGAACGGGCCATGACAAAGGACAATAACCTGCTGGGCAAGTTCGACCTGACCGGGAT
TCCCCCGGCGCCCCGCGGGGTCCCCCAGATTGAGGTCACCTTCGACATCGATGCCAATGGCATCCTCAACGTCACCGCCGCCGACAAGAGCACCGGTAAA
GAAAACAAAATCACCATCACCAACGACAAAGGTCGTCTAAGCAAGGACGACATTGACCGGATGGTGCAGGAGGCTGAGCGGTACAAGTCGGAAGATGAGG
CCAATCGCGACCGGGTAGCCGCCAAAAACGCCGTGGAGTCCTATACCTACAACATCAAGCAGACGGTGGAAGACGAGAAACTGAGGGGCAAGATTAGCGA
GCAGGACAAAAACAAGATCCTCGACAAGTGTCAGGAGGTGATCAACTGGCTCGACCGAAACCAGATGGCGGAGAAAGATGAGTATGAACACAAGCAGAAA
GAGCTCGAAAGAGTGTGCAACCCCATCATCAGCAAACTTTACCAAGGCGGCCCTGGCGGTGGCGGCGGTACTGGAGCCTCCGGGGGACCGACCATCGAGG
AAGTGGAC


>BGISUSP0000877915
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGG
KPKVQVEYKGEIKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLI
FDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGHIHEIVLVGGSTRIPKIHKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVT
PLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGK
ENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGGTGASGGPTIEEVD