Sequences
EST Library Info
cut3Uterus - RNA from China
ebs2Foetus 50 days, brain stem
eep3Foetus 50 days, epidermis
ese3Foetus 50 days, M. semitendinosus
nlu2Newborn 115 days, lung
ova1Ovary
pgl2Pituitary gland
pigca1Unavailable
pigcb7Unavailable
thg1Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000127022 (click for geneview)
Transcript ID ENST00000247461(link to ensembl)
Symbol CANX
Localtion Chromosome:5:179058602:179090532:1 band: 5q35.3
Description Calnexin precursor (Major histocompatibility complex class I antigen- binding protein p88) (p90) (IP90). [Source:Uniprot/SWISSPROT;Acc:P27824]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--G--K--W--L--L--C--M--L--L--V--L--G--T--A--I--V--E--A--H--D--G--H--D--D--D--V--I--D--I--E--D--
ATGGAAGGGAAGTGGTTGCTGTGTATGTTACTGGTGCTTGGAACTGCTATTGTTGAGGCTCATGATGGACATGATGATGATGTGATTGATATTGAGGATG
::::::::::::::::::::.:::::::::::::: ::::::::::::.::::: ::::::::::::::::.::.:::::::::::::::::::::::::
ATGGAAGGGAAGTGGTTGCTATGTATGTTACTGGTCCTTGGAACTGCTGTTGTTCAGGCTCATGATGGACACGACGATGATGTGATTGATATTGAGGATG
-M--E--G--K--W--L--L--C--M--L--L--V--L--G--T--A--V--V--Q--A--H--D--G--H--D--D--D--V--I--D--I--E--D--

----------------------------------------------------------------------------><----------------------
D--L--D--D--V--I--E--E--V--E--D--S--K--P--------D--T--T--A--P--P--S--S--P--K--V--T--Y--K--A--P--V--P
ACCTTGACGATGTCATTGAAGAGGTAGAAGACTCAAAACCA------GATACCACTGCTCCTCCTTCATCTCCCAAGGTTACTTACAAAGCTCCAGTTCC
:::::::.::::::::::::::::::::::::::::::::       ::.:::: :::::: :: ::          ::.::.:::::::::::::::::
ACCTTGATGATGTCATTGAAGAGGTAGAAGACTCAAAACCTAAACCAGACACCAGTGCTCCGCCATCT---------GTCACCTACAAAGCTCCAGTTCC
D--L--D--D--V--I--E--E--V--E--D--S--K--P--K--P--D--T--S--A--P--P--S-----------V--T--Y--K--A--P--V--P

--------------------------------------------------><------------------------------------------------
--T--G--E--V--Y--F--A--D--S--F--D--R--G--T--L--S--G--W--I--L--S--K--A--K--K--D--D--T--D--D--E--I--A-
AACAGGGGAAGTATATTTTGCTGATTCTTTTGACAGAGGAACTCTGTCAGGGTGGATTTTATCCAAAGCCAAGAAAGACGATACCGATGATGAAATTGCC
:::::::::::::::::::::::::::.:::::::::::::::::::::   ::::::::::::::::::::::::::.:::::.:::::::::::::::
AACAGGGGAAGTATATTTTGCTGATTCCTTTGACAGAGGAACTCTGTCA---TGGATTTTATCCAAAGCCAAGAAAGATGATACTGATGATGAAATTGCC
--T--G--E--V--Y--F--A--D--S--F--D--R--G--T--L--S-----W--I--L--S--K--A--K--K--D--D--T--D--D--E--I--A-

---------><-----------------------------------------------------------------------------------------
-K--Y--D--G--K--W--E--V--E--E--M--K--E--S--K--L--P--G--D--K--G--L--V--L--M--S--R--A--K--H--H--A--I--
AAATATGATGGAAAGTGGGAGGTAGAGGAAATGAAGGAGTCAAAGCTTCCAGGTGATAAAGGACTTGTGTTGATGTCTCGGGCCAAGCATCATGCCATCT
:::::::::   ::.:::::.::::: :::::::::::. ::::.:::::::::::::::::::::::.::: :.:::::::::::.::::::::.::::
AAATATGAT---AAATGGGAAGTAGATGAAATGAAGGAAACAAAACTTCCAGGTGATAAAGGACTTGTATTGCTATCTCGGGCCAAACATCATGCTATCT
-K--Y--D-----K--W--E--V--D--E--M--K--E--T--K--L--P--G--D--K--G--L--V--L--L--S--R--A--K--H--H--A--I--

---------------------------------------------------><-----------------------------------------------
S--A--K--L--N--K--P--F--L--F--D--T--K--P--L--I--V--Q--Y--E--V--N--F--Q--N--G--I--E--C--G--G--A--Y--V
CTGCTAAACTGAACAAGCCCTTCCTGTTTGACACCAAGCCTCTCATTGTTCAGTATGAGGTTAATTTCCAAAATGGAATAGAATGTGGTGGTGCCTATGT
:..::::::::::.::::::::: : :::::.::::::::::::::::::   :::::::::::::::::::::::::::::::::::.:::::::::::
CCACTAAACTGAATAAGCCCTTCATCTTTGATACCAAGCCTCTCATTGTT---TATGAGGTTAATTTCCAAAATGGAATAGAATGTGGCGGTGCCTATGT
S--T--K--L--N--K--P--F--I--F--D--T--K--P--L--I--V-----Y--E--V--N--F--Q--N--G--I--E--C--G--G--A--Y--V

---------------------------------><-----------------------------------------------------------------
--K--L--L--S--K--T--P--E--L--N--L--D--Q--F--H--D--K--T--P--Y--T--I--M--F--G--P--D--K--C--G--E--D--Y-
GAAACTGCTTTCTAAAACACCAGAACTCAACCTGGATCAGTTCCATGACAAGACCCCTTATACGATTATGTTTGGTCCAGATAAATGTGGAGAGGACTAT
.:::::.:::::.::::: ::::::::::::::::::::::::::.:::::::::::::::::.:::::::::::::::::::::::::::::.::::::
AAAACTACTTTCCAAAACTCCAGAACTCAACCTGGATCAGTTCCACGACAAGACCCCTTATACAATTATGTTTGGTCCAGATAAATGTGGAGAAGACTAT
--K--L--L--S--K--T--P--E--L--N--L--D--Q--F--H--D--K--T--P--Y--T--I--M--F--G--P--D--K--C--G--E--D--Y-

----------------------------------------------------------------------------------------------------
-K--L--H--F--I--F--R--H--K--N--P--K--T--G--I--Y--E--E--K--H--A--K--R--P--D--A--D--L--K--T--Y--F--T--
AAACTGCACTTCATCTTCCGACACAAAAACCCCAAAACGGGTATCTATGAAGAAAAACATGCTAAGAGGCCAGATGCAGATCTGAAGACCTATTTTACTG
:::.:::::::::::::::: :::::::::::::::::::::.:::::::::::::.:::::::::::::::::::::::::::::::::::::::::::
AAATTGCACTTCATCTTCCGCCACAAAAACCCCAAAACGGGTGTCTATGAAGAAAAGCATGCTAAGAGGCCAGATGCAGATCTGAAGACCTATTTTACTG
-K--L--H--F--I--F--R--H--K--N--P--K--T--G--V--Y--E--E--K--H--A--K--R--P--D--A--D--L--K--T--Y--F--T--

--------------------------><------------------------------------------------------------------------
D--K--K--T--H--L--Y--T--L--I--L--N--P--D--N--S--F--E--I--L--V--D--Q--S--V--V--N--S--G--N--L--L--N--D
ATAAGAAAACACATCTTTACACACTAATCTTGAATCCAGATAATAGTTTTGAAATACTGGTTGACCAATCTGTGGTGAATAGTGGAAATCTGCTCAATGA
:::::::::::::::::::.:::.::   :::::::::::::::::::::::::::.:.:: :::::: :::: :::::::::::.::::::.: :::::
ATAAGAAAACACATCTTTATACATTA---TTGAATCCAGATAATAGTTTTGAAATATTAGTGGACCAAGCTGTTGTGAATAGTGGGAATCTGTTAAATGA
D--K--K--T--H--L--Y--T--L-----L--N--P--D--N--S--F--E--I--L--V--D--Q--A--V--V--N--S--G--N--L--L--N--D

----------------------------------------------------------------------------------------------------
--M--T--P--P--V--N--P--S--R--E--I--E--D--P--E--D--R--K--P--E--D--W--D--E--R--P--K--I--P--D--P--E--A-
CATGACTCCTCCTGTAAATCCTTCACGTGAAATTGAGGACCCAGAAGACCGGAAGCCCGAGGATTGGGATGAAAGACCAAAAATCCCAGATCCAGAAGCT
::::::::::::::::::::::::::::::::::::::::::::::::: :::::::.::.:::::::::::::::::::::::.:::::::: :: :::
CATGACTCCTCCTGTAAATCCTTCACGTGAAATTGAGGACCCAGAAGACAGGAAGCCTGAAGATTGGGATGAAAGACCAAAAATTCCAGATCCTGATGCT
--M--T--P--P--V--N--P--S--R--E--I--E--D--P--E--D--R--K--P--E--D--W--D--E--R--P--K--I--P--D--P--D--A-

----------------><----------------------------------------------------------------------------------
-V--K--P--D--D--W--D--E--D--A--P--A--K--I--P--D--E--E--A--T--K--P--E--G--W--L--D--D--E--P--E--Y--V--
GTCAAGCCAGATGACTGGGATGAAGATGCCCCTGCTAAGATTCCAGATGAAGAGGCCACAAAACCCGAAGGCTGGTTAGATGATGAGCCTGAGTACGTAC
:::::.:::::::::   :::::::::::::::::::::::::::::::::::.::::: ::.::.. ::::::::::::::::::::::::.::.::::
GTCAAACCAGATGAC---GATGAAGATGCCCCTGCTAAGATTCCAGATGAAGAAGCCACTAAGCCTATAGGCTGGTTAGATGATGAGCCTGAATATGTAC
-V--K--P--D--D-----D--E--D--A--P--A--K--I--P--D--E--E--A--T--K--P--I--G--W--L--D--D--E--P--E--Y--V--

------------------------------><--------------------------------------------------------------------
P--D--P--D--A--E--K--P--E--D--W--D--E--D--M--D--G--E--W--E--A--P--Q--I--A--N--P--R--C--E--S--A--P--G
CTGATCCAGACGCAGAGAAACCTGAGGATTGGGATGAAGACATGGATGGAGAATGGGAGGCTCCTCAGATTGCCAACCCTAGATGTGAGTCAGCTCCTGG
::::::::::.::::::::.:: ::::::   ::::::::.:::::::::::.::::::::::::::::::::::::::.:..::::::::.::.:::::
CTGATCCAGATGCAGAGAAGCCAGAGGAT---GATGAAGATATGGATGGAGAGTGGGAGGCTCCTCAGATTGCCAACCCCAAGTGTGAGTCGGCCCCTGG
P--D--P--D--A--E--K--P--E--D-----D--E--D--M--D--G--E--W--E--A--P--Q--I--A--N--P--K--C--E--S--A--P--G

---------------------------------------------------------------------------------------><-----------
--C--G--V--W--Q--R--P--V--I--D--N--P--N--Y--K--G--K--W--K--P--P--M--I--D--N--P--S--Y--Q--G--I--W--K-
ATGTGGTGTCTGGCAGCGACCTGTGATTGACAACCCCAATTATAAAGGCAAATGGAAGCCTCCTATGATTGACAATCCCAGTTACCAGGGAATCTGGAAA
.:::::::::::::::::::::.:::::::::::::.::::::::.:::::::::::.:::::.::::::::::::::.:..::::::::.::.::::::
GTGTGGTGTCTGGCAGCGACCTATGATTGACAACCCTAATTATAAGGGCAAATGGAAACCTCCCATGATTGACAATCCTAACTACCAGGGGATTTGGAAA
--C--G--V--W--Q--R--P--M--I--D--N--P--N--Y--K--G--K--W--K--P--P--M--I--D--N--P--N--Y--Q--G--I--W--K-

----------------------------------------------------------------------------------------------------
-P--R--K--I--P--N--P--D--F--F--E--D--L--E--P--F--R--M--T--P--F--S--A--I--G--L--E--L--W--S--M--T--S--
CCCAGGAAAATACCAAATCCAGATTTCTTTGAAGATCTGGAACCTTTCAGAATGACTCCTTTTAGTGCTATTGGTTTGGAGCTGTGGTCCATGACCTCTG
::: ::::::::::::::::::::::::::::::::.::::::::::::.:::::::::::::::::::::::::::.::.::::::::.:::::::: :
CCCCGGAAAATACCAAATCCAGATTTCTTTGAAGATTTGGAACCTTTCAAAATGACTCCTTTTAGTGCTATTGGTTTAGAACTGTGGTCTATGACCTCGG
-P--R--K--I--P--N--P--D--F--F--E--D--L--E--P--F--K--M--T--P--F--S--A--I--G--L--E--L--W--S--M--T--S--

----------------------------------------------------------------------------------------------------
D--I--F--F--D--N--F--I--I--C--A--D--R--R--I--V--D--D--W--A--N--D--G--W--G--L--K--K--A--A--D--G--A--A
ACATTTTTTTTGACAACTTTATCATTTGTGCTGATCGAAGAATAGTTGATGATTGGGCCAATGATGGATGGGGCCTGAAGAAAGCTGCTGATGGGGCTGC
::::::::::::::::.::.:::::::::: ::::::::::.:.:::::::::::::::::::::::::::::.::::::::.:::::.:::::::::::
ACATTTTTTTTGACAATTTCATCATTTGTGGTGATCGAAGAGTGGTTGATGATTGGGCCAATGATGGATGGGGTCTGAAGAAGGCTGCCGATGGGGCTGC
D--I--F--F--D--N--F--I--I--C--G--D--R--R--V--V--D--D--W--A--N--D--G--W--G--L--K--K--A--A--D--G--A--A

---><-----------------------------------------------------------------------------------------------
--E--P--G--V--V--G--Q--M--I--E--A--A--E--E--R--P--W--L--W--V--V--Y--I--L--T--V--A--L--P--V--F--L--V-
TGAGCCAGGCGTTGTGGGGCAGATGATCGAGGCAGCTGAAGAGCGCCCGTGGCTGTGGGTAGTCTATATTCTAACTGTAGCCCTTCCTGTGTTCCTGGTT
:::::::::.:: ::::::::::::::.::::::::.::.::::::::.::::: :::::.::.::::::.:.:::::.:: .: ::::::::.:: ::.
TGAGCCAGGTGTGGTGGGGCAGATGATTGAGGCAGCCGAGGAGCGCCCATGGCTCTGGGTGGTTTATATTTTGACTGTGGCATTACCTGTGTTTCTTGTC
--E--P--G--V--V--G--Q--M--I--E--A--A--E--E--R--P--W--L--W--V--V--Y--I--L--T--V--A--L--P--V--F--L--V-

-----------------------><---------------------------------------------------------------------------
-I--L--F--C--C--S--G--K--K--Q--T--S--G--M--E--Y--K--K--T--D--A--P--Q--P--D--V--K--E--E--E--E--E--K--
ATCCTCTTCTGCTGTTCTGGAAAGAAACAGACCAGTGGTATGGAGTATAAGAAAACTGATGCACCTCAACCGGATGTGAAGGAAGAGGAAGAAGAGAAGG
::::::::::::::::::::::::::::::.:::::  :.:::::::::::::.:::::::: ::::::::.:::::::::::.::.::::::::.::::
ATCCTCTTCTGCTGTTCTGGAAAGAAACAGGCCAGTCCTGTGGAGTATAAGAAGACTGATGCTCCTCAACCAGATGTGAAGGAGGAAGAAGAAGAAAAGG
-I--L--F--C--C--S--G--K--K--Q--A--S--P--V--E--Y--K--K--T--D--A--P--Q--P--D--V--K--E--E--E--E--E--K--

--------------------------------------------------><------------------------------------------------
E--E--E--K--D--K--G--D--E--E--E--E--G--E--E--K--L--E--E--K--Q--K--S--D--A--E--E--D--G--G--T--V--S--Q
AAGAGGAAAAGGACAAGGGAGATGAGGAGGAGGAAGGAGAAGAGAAACTTGAAGAGAAACAGAAAAGTGATGCTGAAGAAGATGGTGGCACTGTCAGTCA
::::.::.::::: ::::::::::::::::::::::: ::::::::::::   :::::.::.:.:.:.::::::::::::::::::::::::::::::::
AAGAAGAGAAGGAAAAGGGAGATGAGGAGGAGGAAGGTGAAGAGAAACTT---GAGAAGCAAAGAGGCGATGCTGAAGAAGATGGTGGCACTGTCAGTCA
E--E--E--K--E--K--G--D--E--E--E--E--G--E--E--K--L-----E--K--Q--R--G--D--A--E--E--D--G--G--T--V--S--H

------------------------------><---------------------------------------------------->
--E--E--E--D--R--K--P--K--A--E--E--D--E--I--L--N--R--S--P--R--N--R--K--P--R--R--E--*-
AGAGGAGGAAGACAGAAAACCTAAAGCAGAGGAGGATGAAATTTTGAACAGATCACCAAGAAACAGAAAGCCACGAAGAGAGTGA
 :::::::::::.::.::::: ::::::   ::::::::::::::::::::::: ::::::::::::::::::::::::::::::
TGAGGAGGAAGATAGGAAACCGAAAGCA---GAGGATGAAATTTTGAACAGATCTCCAAGAAACAGAAAGCCACGAAGAGAGTGA
--E--E--E--D--R--K--P--K--A-----E--D--E--I--L--N--R--S--P--R--N--R--K--P--R--R--E--*-

Pig Consensus Sequence

>BGISUST0000888970
ATGGAAGGGAAGTGGTTGCTATGTATGTTACTGGTCCTTGGAACTGCTGTTGTTCAGGCTCATGATGGACACGACGATGATGTGATTGATATTGAGGATG
ACCTTGATGATGTCATTGAAGAGGTAGAAGACTCAAAACCTAAACCAGACACCAGTGCTCCG---------GTCACCTACAAAGCTCCAGTTCCAACAGG
GGAAGTATATTTTGCTGATTCCTTTGACAGAGGAACTCTGTCA---TGGATTTTATCCAAAGCCAAGAAAGATGATACTGATGATGAAATTGCCAAATAT
GAT---AAATGGGAAGTAGATGAAATGAAGGAAACAAAACTTCCAGGTGATAAAGGACTTGTATTGCTATCTCGGGCCAAACATCATGCTATCTCCACTA
AACTGAATAAGCCCTTCATCTTTGATACCAAGCCTCTCATTGTT---TATGAGGTTAATTTCCAAAATGGAATAGAATGTGGCGGTGCCTATGTAAAACT
ACTTTCCAAAACTCCAGAACTCAACCTGGATCAGTTCCACGACAAGACCCCTTATACAATTATGTTTGGTCCAGATAAATGTGGAGAAGACTATAAATTG
CACTTCATCTTCCGCCACAAAAACCCCAAAACGGGTGTCTATGAAGAAAAGCATGCTAAGAGGCCAGATGCAGATCTGAAGACCTATTTTACTGATAAGA
AAACACATCTTTATACATTA---TTGAATCCAGATAATAGTTTTGAAATATTAGTGGACCAAGCTGTTGTGAATAGTGGGAATCTGTTAAATGACATGAC
TCCTCCTGTAAATCCTTCACGTGAAATTGAGGACCCAGAAGACAGGAAGCCTGAAGATTGGGATGAAAGACCAAAAATTCCAGATCCTGATGCTGTCAAA
CCAGATGAC---GATGAAGATGCCCCTGCTAAGATTCCAGATGAAGAAGCCACTAAGCCTATAGGCTGGTTAGATGATGAGCCTGAATATGTACCTGATC
CAGATGCAGAGAAGCCAGAGGAT---GATGAAGATATGGATGGAGAGTGGGAGGCTCCTCAGATTGCCAACCCCAAGTGTGAGTCGGCCCCTGGGTGTGG
TGTCTGGCAGCGACCTATGATTGACAACCCTAATTATAAGGGCAAATGGAAACCTCCCATGATTGACAATCCTAACTACCAGGGGATTTGGAAACCCCGG
AAAATACCAAATCCAGATTTCTTTGAAGATTTGGAACCTTTCAAAATGACTCCTTTTAGTGCTATTGGTTTAGAACTGTGGTCTATGACCTCGGACATTT
TTTTTGACAATTTCATCATTTGTGGTGATCGAAGAGTGGTTGATGATTGGGCCAATGATGGATGGGGTCTGAAGAAGGCTGCCGATGGGGCTGCTGAGCC
AGGTGTGGTGGGGCAGATGATTGAGGCAGCCGAGGAGCGCCCATGGCTCTGGGTGGTTTATATTTTGACTGTGGCATTACCTGTGTTTCTTGTCATCCTC
TTCTGCTGTTCTGGAAAGAAACAGGCCAGTCCTGTGGAGTATAAGAAGACTGATGCTCCTCAACCAGATGTGAAGGAGGAAGAAGAAGAAAAGGAAGAAG
AGAAGGAAAAGGGAGATGAGGAGGAGGAAGGTGAAGAGAAACTT---GAGAAGCAAAGAGGCGATGCTGAAGAAGATGGTGGCACTGTCAGTCATGAGGA
GGAAGATAGGAAACCGAAAGCA---GAGGATGAAATTTTGAACAGATCTCCAAGAAACAGAAAGCCACGAAGAGAGTGA


>BGISUSP0000888970
MEGKWLLCMLLVLGTAVVQAHDGHDDDVIDIEDDLDDVIEEVEDSKPKPDTSAP---VTYKAPVPTGEVYFADSFDRGTLS-WILSKAKKDDTDDEIAKY
D-KWEVDEMKETKLPGDKGLVLLSRAKHHAISTKLNKPFIFDTKPLIV-YEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKL
HFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTL-LNPDNSFEILVDQAVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPDAVK
PDD-DEDAPAKIPDEEATKPIGWLDDEPEYVPDPDAEKPED-DEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPR
KIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIICGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILTVALPVFLVIL
FCCSGKKQASPVEYKKTDAPQPDVKEEEEEKEEEKEKGDEEEEGEEKL-EKQRGDAEEDGGTVSHEEEDRKPKA-EDEILNRSPRNRKPRRE*