Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000127962 (click for geneview)
Transcript ID ENST00000248614(link to ensembl)
Symbol XP_294370.3
Localtion Chromosome:7:79732638:79785896:-1 band: 7q21.11
Description PREDICTED: guanine nucleotide binding protein, alpha transducing 3
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-K--M--G--S--G--I--S--S--E--S--K--E--S--A--K--R--S--K--E--L--E--K--K--L--Q--E--D--A--E--R--D--A--R--
AAGATGGGAAGTGGAATTAGTTCAGAGAGCAAGGAGTCAGCCAAAAGATCAAAAGAACTGGAGAAAAAGCTTCAGGAGGATGCTGAGCGAGATGCAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------><-----------------------------------------><-----------------------------------
T--V--K--L--L--L--L--G--A--G--E--S--G--K--S--T--I--V--K--Q--M--K--I--I--H--K--N--G--Y--S--E--Q--E--C
CCGTAAAGCTGCTACTATTAGGAGCAGGAGAATCTGGGAAAAGTACTATTGTTAAACAAATGAAGATCATCCATAAGAATGGTTACAGTGAGCAAGAATG
                                                                 :::::::::::::::::::::::::::::::::::
-----------------------------------------------------------------ATCATCCATAAGAATGGTTACAGTGAGCAAGAATG
------------------------------------------------------------------I--I--H--K--N--G--Y--S--E--Q--E--C

----------------------------------------------------------------------------------------------------
--M--E--F--K--A--V--I--Y--S--N--T--L--Q--S--I--L--A--I--V--K--A--M--T--T--L--G--I--D--Y--V--N--P--R-
CATGGAGTTCAAAGCAGTAATTTACAGTAATACATTGCAATCCATCCTAGCTATTGTGAAAGCCATGACTACCCTTGGAATTGATTATGTAAATCCCAGA
::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::.::::::::::.::::::::::.::::::::::
CATGGAGTTCAAAGCAGTAATTTACAGTAATACATTGCAATCCATCTTAGCTATTGTGAAAGCCATGGCTACCCTTGGGATTGATTATGCAAATCCCAGA
--M--E--F--K--A--V--I--Y--S--N--T--L--Q--S--I--L--A--I--V--K--A--M--A--T--L--G--I--D--Y--A--N--P--R-

-----><---------------------------------------------------------------------------------------------
-S--A--E--D--Q--R--Q--L--Y--A--M--A--N--T--L--E--D--G--G--M--T--P--Q--L--A--E--V--I--K--R--L--W--R--
AGTGCAGAGGACCAACGACAACTTTATGCAATGGCAAATACCCTGGAAGATGGTGGCATGACACCTCAACTGGCTGAGGTAATAAAACGGCTGTGGAGAG
::::::::.:::::::: ::::::.:::..::::::::::::::::::::::::.:  ::::.::: :..:::::::::::::::::::.::::::::::
AGTGCAGAAGACCAACGCCAACTTCATGTGATGGCAAATACCCTGGAAGATGGTAGATTGACGCCTGAGTTGGCTGAGGTAATAAAACGACTGTGGAGAG
-S--A--E--D--Q--R--Q--L--H--V--M--A--N--T--L--E--D--G--R--L--T--P--E--L--A--E--V--I--K--R--L--W--R--

---------------------------------------------------------------><-----------------------------------
D--P--G--I--Q--A--C--F--E--R--A--S--E--Y--Q--L--N--D--S--A--A--Y--Y--L--N--D--L--D--R--I--T--A--S--G
ATCCAGGAATTCAGGCCTGCTTTGAAAGGGCATCTGAATATCAGCTCAATGACTCAGCAGCTTACTACCTTAATGATTTAGATAGAATAACAGCATCTGG
:::::::::::::::::::::::::::::::::::::::::::.::::::                                                  
ATCCAGGAATTCAGGCCTGCTTTGAAAGGGCATCTGAATATCAACTCAAT--------------------------------------------------
D--P--G--I--Q--A--C--F--E--R--A--S--E--Y--Q--L--N---------------------------------------------------

--------------------------------------------------------------------------------------------><------
--Y--V--P--N--E--Q--D--V--L--H--S--R--V--K--T--T--G--I--I--E--T--Q--F--S--F--K--D--L--H--F--R--M--F-
GTATGTGCCAAATGAACAAGATGTTCTCCATTCTCGAGTGAAAACGACTGGAATCATTGAAACTCAATTCTCCTTTAAAGACTTGCACTTCAGGATGTTT
                                                                                              :::::.
----------------------------------------------------------------------------------------------ATGTTC
-----------------------------------------------------------------------------------------------M--F-

----------------------------------------------------------------------------------------------------
-D--V--G--G--Q--R--S--E--R--K--K--W--I--H--C--F--E--G--V--T--C--I--I--F--C--A--A--L--S--A--Y--D--M--
GATGTAGGTGGACAGAGATCTGAGAGAAAGAAGTGGATTCACTGCTTTGAAGGAGTTACATGCATTATATTTTGTGCTGCACTTAGTGCCTATGACATGG
:::::::::::.::::::::::::::::::::.::::::::.::::::::::: :::::::::::::::::::::::. ::::.:::::.::::::::::
GATGTAGGTGGGCAGAGATCTGAGAGAAAGAAATGGATTCATTGCTTTGAAGGCGTTACATGCATTATATTTTGTGCCTCACTCAGTGCTTATGACATGG
-D--V--G--G--Q--R--S--E--R--K--K--W--I--H--C--F--E--G--V--T--C--I--I--F--C--A--S--L--S--A--Y--D--M--

----------------------><----------------------------------------------------------------------------
V--L--V--E--D--E--E--V--N--R--M--H--E--S--L--H--L--F--N--S--I--C--N--H--K--Y--F--S--T--T--S--I--V--L
TCCTCGTGGAAGACGAAGAAGTGAATAGAATGCATGAAAGCCTTCACCTGTTCAACAGTATCTGTAATCACAAGTATTTTTCAACAACCTCCATTGTCCT
:::: ::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::.::: :::: ::::::::::::::
TCCTGGTGGAAGATGAAGAAGTGAACAGAATGCATGAAAGCCTTCACCTGTTCAACAGTATCTGCAATCACAAGTACTTTGCAACCACCTCCATTGTCCT
V--L--V--E--D--E--E--V--N--R--M--H--E--S--L--H--L--F--N--S--I--C--N--H--K--Y--F--A--T--T--S--I--V--L

----------------------------------------------------------------------------><----------------------
--F--L--N--K--K--D--I--F--Q--E--K--V--T--K--V--H--L--S--I--C--F--P--E--Y--T--G--P--N--T--F--E--D--A-
GTTCCTCAACAAAAAAGATATCTTTCAAGAAAAGGTAACCAAGGTGCATCTTAGTATCTGCTTTCCAGAATACACTGGGCCAAATACATTTGAAGATGCA
:::.:::::.::::::::: :::::::::::::.::::::::::::::::::::::::::::::::::::::.:::   :::::::::::::::::::::
GTTTCTCAATAAAAAAGATCTCTTTCAAGAAAAAGTAACCAAGGTGCATCTTAGTATCTGCTTTCCAGAATATACT---CCAAATACATTTGAAGATGCA
--F--L--N--K--K--D--L--F--Q--E--K--V--T--K--V--H--L--S--I--C--F--P--E--Y--T-----P--N--T--F--E--D--A-

----------------------------------------------------------------------------------------------------
-G--N--Y--I--K--N--Q--F--L--D--L--N--L--K--K--E--D--K--E--I--Y--S--H--M--T--C--A--T--D--T--Q--N--V--
GGAAACTACATCAAGAACCAGTTTCTAGACCTGAATTTAAAAAAAGAAGATAAGGAAATTTATTCCCACATGACCTGTGCTACTGACACCCAAAATGTCA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::.::.::.:::::::
GGAAACTACATCAAGAACCAGTTTCTAGACCTGAATTTAAAAAAAGAAGATAAGGAAATTTATTCCCACATGACCTGTGCTACAGATACTCAGAATGTCA
-G--N--Y--I--K--N--Q--F--L--D--L--N--L--K--K--E--D--K--E--I--Y--S--H--M--T--C--A--T--D--T--Q--N--V--

------------------------------------------------------------------->
K--F--V--F--D--A--V--T--D--I--I--I--K--E--N--L--K--D--C--G--L--F--*-
AGTTTGTGTTTGACGCAGTTACAGATATAATAATCAAAGAGAATCTAAAAGACTGTGGGCTTTTCTAA
::::.::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::::
AGTTCGTGTTTGATGCAGTTACAGACATAATAATCAAAGAGAATCTAAAAGACTGTGGGCTTTTCTAA
K--F--V--F--D--A--V--T--D--I--I--I--K--E--N--L--K--D--C--G--L--F--*-

Pig Consensus Sequence

>BGISUST0000898154
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------ATCATCCATAAGAATGGTTACAGTGAGCAAGAATG
CATGGAGTTCAAAGCAGTAATTTACAGTAATACATTGCAATCCATCTTAGCTATTGTGAAAGCCATGGCTACCCTTGGGATTGATTATGCAAATCCCAGA
AGTGCAGAAGACCAACGCCAACTTCATGTGATGGCAAATACCCTGGAAGATGGTAGATTGACGCCTGAGTTGGCTGAGGTAATAAAACGACTGTGGAGAG
ATCCAGGAATTCAGGCCTGCTTTGAAAGGGCATCTGAATATCAACTCAAT--------------------------------------------------
----------------------------------------------------------------------------------------------ATGTTC
GATGTAGGTGGGCAGAGATCTGAGAGAAAGAAATGGATTCATTGCTTTGAAGGCGTTACATGCATTATATTTTGTGCCTCACTCAGTGCTTATGACATGG
TCCTGGTGGAAGATGAAGAAGTGAACAGAATGCATGAAAGCCTTCACCTGTTCAACAGTATCTGCAATCACAAGTACTTTGCAACCACCTCCATTGTCCT
GTTTCTCAATAAAAAAGATCTCTTTCAAGAAAAAGTAACCAAGGTGCATCTTAGTATCTGCTTTCCAGAATATACT---CCAAATACATTTGAAGATGCA
GGAAACTACATCAAGAACCAGTTTCTAGACCTGAATTTAAAAAAAGAAGATAAGGAAATTTATTCCCACATGACCTGTGCTACAGATACTCAGAATGTCA
AGTTCGTGTTTGATGCAGTTACAGACATAATAATCAAAGAGAATCTAAAAGACTGTGGGCTTTTCTAA


>BGISUSP0000898154
-------------------------------------------------------IIHKNGYSEQECMEFKAVIYSNTLQSILAIVKAMATLGIDYANPR
SAEDQRQLHVMANTLEDGRLTPELAEVIKRLWRDPGIQACFERASEYQLN------------------------------------------------MF
DVGGQRSERKKWIHCFEGVTCIIFCASLSAYDMVLVEDEEVNRMHESLHLFNSICNHKYFATTSIVLFLNKKDLFQEKVTKVHLSICFPEYT-PNTFEDA
GNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF*