Sequences
EST Library Info
hyp6Hypothalamus
Clusters
Oligos
SNPs

Gene ID ENSG00000128872 (click for geneview)
Transcript ID ENST00000249700(link to ensembl)
Symbol TMOD2
Localtion Chromosome:15:49831102:49889634:1 band: 15q21.2
Description Tropomodulin-2 (Neuronal tropomodulin) (N-Tmod). [Source:Uniprot/SWISSPROT;Acc:Q9NZR1]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--L--P--F--Q--K--E--L--E--K--Y--K--N--I--D--E--D--E--L--L--G--K--L--S--E--E--E--L--K--Q--L--E--
ATGGCACTCCCCTTTCAAAAAGAGCTGGAGAAATACAAGAACATTGATGAAGATGAGCTTCTTGGCAAACTCTCAGAAGAGGAACTGAAACAGTTGGAAA
:::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGGCACTCCCTTTTCAAAAAGAGCTGGAGAAATACAAGAACATTGATGAAGATGAGCTTCTTGGCAAACTCTCAGAAGAGGAACTGAAACAGTTGGAAA
-M--A--L--P--F--Q--K--E--L--E--K--Y--K--N--I--D--E--D--E--L--L--G--K--L--S--E--E--E--L--K--Q--L--E--

-------------------------><-------------------------------------------------------------------------
N--V--L--D--D--L--D--P--E--S--A--M--L--P--A--G--F--R--Q--K--D--Q--T--Q--K--A--A--T--G--P--F--D--R--E
ATGTTCTAGATGACCTAGATCCTGAGAGTGCCATGCTGCCAGCTGGATTTCGACAGAAAGACCAGACACAGAAGGCAGCCACCGGCCCCTTTGACCGCGA
::::::: ::::::::::::::.:::                                                                          
ATGTTCTTGATGACCTAGATCCCGAG--------------------------------------------------------------------------
N--V--L--D--D--L--D--P--E---------------------------------------------------------------------------

----------------------------------------------------------------------------------><----------------
--H--L--L--M--Y--L--E--K--E--A--L--E--Q--K--D--R--E--D--F--V--P--F--T--G--E--K--K--G--R--V--F--I--P-
GCACCTCCTCATGTACCTGGAGAAGGAGGCTTTGGAACAGAAAGACAGAGAGGACTTTGTGCCCTTCACTGGAGAAAAGAAAGGGAGAGTCTTTATCCCT
                                                                                     ::::::::::::::.
-------------------------------------------------------------------------------------AGAGTCTTTATCCCC
--------------------------------------------------------------------------------------R--V--F--I--P-

----------------------------------------------------------------------------------------------------
-K--E--K--P--I--E--T--R--K--E--E--K--V--T--L--D--P--E--L--E--E--A--L--A--S--A--S--D--T--E--L--Y--D--
AAAGAAAAGCCTATAGAAACTCGTAAAGAAGAAAAAGTGACCCTTGACCCAGAACTGGAAGAAGCTTTGGCCAGTGCCTCTGACACCGAACTCTATGATC
::::::::::::.::::::::::::::::::::::::::::::: :::::::::.:::::::::::::::::::.::::: :::::::::::::::::.:
AAAGAAAAGCCTGTAGAAACTCGTAAAGAAGAAAAAGTGACCCTGGACCCAGAATTGGAAGAAGCTTTGGCCAGCGCCTCGGACACCGAACTCTATGACC
-K--E--K--P--V--E--T--R--K--E--E--K--V--T--L--D--P--E--L--E--E--A--L--A--S--A--S--D--T--E--L--Y--D--

-----><-------------------------------------------------------------------------------------><------
L--A--A--V--L--G--V--H--N--L--L--N--N--P--K--F--D--E--E--T--A--N--N--K--G--G--K--G--P--V--R--N--V--V
TTGCAGCTGTCCTTGGAGTACACAATTTGCTCAACAATCCAAAGTTCGATGAAGAAACAGCCAACAATAAAGGTGGCAAAGGACCTGTCAGAAATGTTGT
:::::   ::.:::::::::::::::.:.::::::::::: :::::.::::::::::::.:...::  ::::: ::::::::.::::: :::   :: ::
TTGCA---GTTCTTGGAGTACACAATCTACTCAACAATCCCAAGTTTGATGAAGAAACAACTGGCACAAAAGGAGGCAAAGGGCCTGTGAGA---GTAGT
L--A-----V--L--G--V--H--N--L--L--N--N--P--K--F--D--E--E--T--T--G--T--K--G--G--K--G--P--V--R-----V--V

----------------------------------------------------------------------------------------------------
--K--G--E--K--V--K--P--V--F--E--E--P--P--N--P--T--N--V--E--I--S--L--Q--Q--M--K--A--N--D--P--S--L--Q-
CAAAGGTGAAAAAGTAAAGCCAGTATTTGAGGAACCACCAAATCCCACAAATGTGGAAATAAGCCTGCAGCAGATGAAAGCCAATGATCCTAGCTTGCAA
::::::::::::.::.::::::::::::::::::::::: ::::::::::::::::::.::::.::.::::::::::::::.::::::::.:::.:::::
CAAAGGTGAAAAGGTGAAGCCAGTATTTGAGGAACCACCCAATCCCACAAATGTGGAAGTAAGTCTACAGCAGATGAAAGCTAATGATCCCAGCCTGCAA
--K--G--E--K--V--K--P--V--F--E--E--P--P--N--P--T--N--V--E--V--S--L--Q--Q--M--K--A--N--D--P--S--L--Q-

-----------------------><---------------------------------------------------------------------------
-E--V--N--L--N--N--I--K--N--I--P--I--P--T--L--R--E--F--A--K--A--L--E--T--N--T--H--V--K--K--F--S--L--
GAAGTCAACCTCAACAACATTAAGAACATTCCAATTCCAACCCTGAGGGAATTTGCAAAGGCTCTGGAGACCAACACTCACGTGAAGAAGTTCAGCCTGG
::.:::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::.::::::::.:::::::::::::::::::::::::
GAGGTCAACCTCAACAACATTAAGAACATTCCAATTCCAACCCTGAAGGAATTTGCAAAGGCTCTAGAGACCAATACTCACGTGAAGAAGTTCAGCCTGG
-E--V--N--L--N--N--I--K--N--I--P--I--P--T--L--K--E--F--A--K--A--L--E--T--N--T--H--V--K--K--F--S--L--

-------------------------------><-------------------------------------------------------------------
A--A--T--R--S--N--D--P--V--A--I--A--F--A--D--M--L--K--V--N--K--T--L--T--S--L--N--I--E--S--N--F--I--T
CCGCAACTCGCAGCAATGACCCTGTGGCCATTGCTTTTGCAGACATGCTGAAAGTAAACAAGACCTTGACAAGTCTAAACATAGAATCCAATTTTATCAC
: :::::.:: :::::::::::::::::    :::::::::::.:::::.::::::::::::::::::: ::::::::::::::::::.:::::::::::
CGGCAACCCGAAGCAATGACCCTGTGGCA---GCTTTTGCAGATATGCTAAAAGTAAACAAGACCTTGAAAAGTCTAAACATAGAATCTAATTTTATCAC
A--A--T--R--S--N--D--P--V--A-----A--F--A--D--M--L--K--V--N--K--T--L--K--S--L--N--I--E--S--N--F--I--T

---------------------------------------------------------------------------><-----------------------
--G--T--G--I--L--A--L--V--E--A--L--K--E--N--D--T--L--T--E--I--K--I--D--N--Q--R--Q--Q--L--G--T--A--V-
TGGAACTGGGATCCTGGCCCTGGTAGAGGCACTGAAAGAAAATGACACCTTGACAGAAATCAAGATTGACAACCAGAGGCAGCAGTTGGGAACAGCTGTA
.:: .:::::::::::::::: ::::::::..:.:::::::::::::: ::::::::.::::::::.:::::::::::.::::::: ::::::::::: :
CGGTGCTGGGATCCTGGCCCTTGTAGAGGCGTTAAAAGAAAATGACACATTGACAGAGATCAAGATCGACAACCAGAGACAGCAGTAGGGAACAGCTGAA
--G--A--G--I--L--A--L--V--E--A--L--K--E--N--D--T--L--T--E--I--K--I--D--N--Q--R--Q--Q--*--G--T--A--E-

----------------------------------------------------------------------------------------------------
-E--M--E--I--A--Q--M--L--E--E--N--S--R--I--L--K--F--G--Y--Q--F--T--K--Q--G--P--R--T--R--V--A--A--A--
GAGATGGAAATTGCCCAGATGCTGGAGGAGAATTCAAGGATCCTCAAGTTTGGATACCAGTTTACCAAGCAAGGGCCACGAACAAGGGTGGCAGCTGCCA
::::::::::::::::::::::: ::::::                                                                      
GAGATGGAAATTGCCCAGATGCTCGAGGAG----------------------------------------------------------------------
-E--M--E--I--A--Q--M--L--E--E-----------------------------------------------------------------------

--------------------><--------------------------------->
I--T--K--N--N--D--L--V--R--K--K--R--V--E--A--D--R--R--*-
TCACAAAGAATAATGACCTGGTTCGTAAGAAGAGAGTTGAAGCAGACCGAAGGTAA
                                                        
--------------------------------------------------------
--------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000891516
ATGGCACTCCCTTTTCAAAAAGAGCTGGAGAAATACAAGAACATTGATGAAGATGAGCTTCTTGGCAAACTCTCAGAAGAGGAACTGAAACAGTTGGAAA
ATGTTCTTGATGACCTAGATCCCGAG--------------------------------------------------------------------------
-------------------------------------------------------------------------------------AGAGTCTTTATCCCC
AAAGAAAAGCCTGTAGAAACTCGTAAAGAAGAAAAAGTGACCCTGGACCCAGAATTGGAAGAAGCTTTGGCCAGCGCCTCGGACACCGAACTCTATGACC
TTGCA---GTTCTTGGAGTACACAATCTACTCAACAATCCCAAGTTTGATGAAGAAACAACTGGCACAAAAGGAGGCAAAGGGCCTGTGAGA---GTAGT
CAAAGGTGAAAAGGTGAAGCCAGTATTTGAGGAACCACCCAATCCCACAAATGTGGAAGTAAGTCTACAGCAGATGAAAGCTAATGATCCCAGCCTGCAA
GAGGTCAACCTCAACAACATTAAGAACATTCCAATTCCAACCCTGAAGGAATTTGCAAAGGCTCTAGAGACCAATACTCACGTGAAGAAGTTCAGCCTGG
CGGCAACCCGAAGCAATGACCCTGTGGCA---GCTTTTGCAGATATGCTAAAAGTAAACAAGACCTTGAAAAGTCTAAACATAGAATCTAATTTTATCAC
CGGTGCTGGGATCCTGGCCCTTGTAGAGGCGTTAAAAGAAAATGACACATTGACAGAGATCAAGATCGACAACCAGAGACAGCAGTAGGGAACAGCTGAA
GAGATGGAAATTGCCCAGATGCTCGAGGAG----------------------------------------------------------------------
--------------------------------------------------------


>BGISUSP0000891516
MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPE-----------------------------------------------------RVFIP
KEKPVETRKEEKVTLDPELEEALASASDTELYDLA-VLGVHNLLNNPKFDEETTGTKGGKGPVR-VVKGEKVKPVFEEPPNPTNVEVSLQQMKANDPSLQ
EVNLNNIKNIPIPTLKEFAKALETNTHVKKFSLAATRSNDPVA-AFADMLKVNKTLKSLNIESNFITGAGILALVEALKENDTLTEIKIDNQRQQ*GTAE
EMEIAQMLEE------------------------------------------