Sequences
EST Library Info
nbm2Newborn 115 days, bone marrow (pelvis)
plac1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000129194 (click for geneview)
Transcript ID ENST00000250055(link to ensembl)
Symbol SOX15
Localtion Chromosome:17:7432222:7434212:-1 band: 17p13.1
Description SOX-15 protein (SOX-20 protein) (SOX-12 protein). [Source:Uniprot/SWISSPROT;Acc:O60248]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--L--P--G--S--S--Q--D--Q--A--W--S--L--E--P--P--A--A--T--A--A--A--S--S--S--S--G--P--Q--E--R--E--
ATGGCGCTACCAGGCTCCTCACAGGACCAGGCCTGGAGCCTGGAGCCTCCGGCTGCCACGGCTGCTGCCTCCTCATCTTCGGGACCCCAGGAGCGGGAGG
::::::::::: :::::::: :::::.::::::::::::::::::::::: .:: ::.::::. : .::::: ::::.::::: .:::::::::::::::
ATGGCGCTACCCGGCTCCTCTCAGGATCAGGCCTGGAGCCTGGAGCCTCCCACTCCCGCGGCCCCGACCTCCGCATCCTCGGGCTCCCAGGAGCGGGAGG
-M--A--L--P--G--S--S--Q--D--Q--A--W--S--L--E--P--P--T--P--A--A--P--T--S--A--S--S--G--S--Q--E--R--E--

----------------------------------------------------------------------------------------------------
G--A--G--S--P--A--A--P--G--T--L--P--L--E--K--V--K--R--P--M--N--A--F--M--V--W--S--S--A--Q--R--R--Q--M
GCGCTGGGAGCCCCGCGGCCCCCGGGACGCTGCCCCTGGAGAAGGTGAAGCGGCCGATGAACGCGTTCATGGTGTGGAGCTCCGCTCAGCGCCGCCAGAT
::::.:::::::: :.::.:.:::::. ::: :::.::::::::::::::::::: :::::::::::::::::::::::::::::.::::::::::::::
GCGCCGGGAGCCCAGTGGTCTCCGGGGGGCTTCCCTTGGAGAAGGTGAAGCGGCCCATGAACGCGTTCATGGTGTGGAGCTCCGCCCAGCGCCGCCAGAT
G--A--G--S--P--V--V--S--G--G--L--P--L--E--K--V--K--R--P--M--N--A--F--M--V--W--S--S--A--Q--R--R--Q--M

----------------------------------------------------------------------------------------------------
--A--Q--Q--N--P--K--M--H--N--S--E--I--S--K--R--L--G--A--Q--W--K--L--L--D--E--D--E--K--R--P--F--V--E-
GGCGCAGCAGAACCCCAAGATGCACAACTCCGAGATCTCCAAGCGCCTGGGCGCGCAGTGGAAGCTGCTGGACGAGGACGAGAAGCGGCCCTTCGTGGAG
::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::
GGCGCAGCAGAACCCGAAGATGCACAACTCCGAGATCTCCAAGCGCCTGGGCGCGCAGTGGAAGCTGCTGGGCGAGGACGAGAAGCGGCCCTTCGTGGAG
--A--Q--Q--N--P--K--M--H--N--S--E--I--S--K--R--L--G--A--Q--W--K--L--L--G--E--D--E--K--R--P--F--V--E-

----------------------------------------------------------------------------------------------------
-E--A--K--R--L--R--A--R--H--L--R--D--Y--P--D--Y--K--Y--R--P--R--R--K--A--K--S--S--G--A--G--P--S--R--
GAGGCCAAGCGGCTCCGCGCCCGACACCTGCGCGACTACCCCGACTACAAGTACCGGCCTCGGCGCAAGGCCAAGAGCTCGGGCGCCGGACCTTCCCGCT
:::::.::::::::::: :::::.:::::::::::::::::::::::::::::::::::.:::::::::.:::::: :::::: :::::..:  :::.::
GAGGCTAAGCGGCTCCGGGCCCGGCACCTGCGCGACTACCCCGACTACAAGTACCGGCCCCGGCGCAAGACCAAGACCTCGGGGGCCGGGTCAGCCCACT
-E--A--K--R--L--R--A--R--H--L--R--D--Y--P--D--Y--K--Y--R--P--R--R--K--T--K--T--S--G--A--G--S--A--H--

----------------------------------------------------------------------------------------------------
C--G--Q--G--R--G--N--L--A--S--G--G--P--L--W--G--P--G--Y--A--T--T--Q--P--S--R--G--F--G--Y--R--P--P--S
GCGGACAGGGAAGAGGCAACCTGGCCAGCGGCGGCCCGCTCTGGGGGCCGGGGTACGCGACCACCCAACCGAGCAGAGGCTTTGGGTACAGACCCCCCAG
 ::: :::::::: .::... ::::..::::::: ::: :::::::::: :::::::::::.: :::.  ::::::::::::::::::: ..:::::::.
TCGGCCAGGGAAGCAGCGGTGTGGCTGGCGGCGGGCCGGTCTGGGGGCCCGGGTACGCGACTAACCAGGGGAGCAGAGGCTTTGGGTACCAGCCCCCCAA
F--G--Q--G--S--S--G--V--A--G--G--G--P--V--W--G--P--G--Y--A--T--N--Q--G--S--R--G--F--G--Y--Q--P--P--N

--------------------------------><------------------------------------------------------------------
--Y--S--T--A--Y--L--P--G--S--Y--G--S--S--H--C--K--L--E--A--P--S--P--C--S--L--P--Q--S--D--P--R--L--Q-
CTACTCGACAGCCTACCTGCCTGGCAGCTATGGCTCTTCCCACTGCAAACTGGAAGCCCCCTCACCGTGCTCCCTCCCTCAGAGTGACCCTAGGCTCCAG
:::::::::::::::::::::::::         :::::::::::.::::.:::.:::::.::.:::::::::::::::::::::.::::.:::::::::
CTACTCGACAGCCTACCTGCCTGGC---------TCTTCCCACTGTAAACCGGAGGCCCCTTCGCCGTGCTCCCTCCCTCAGAGTAACCCCAGGCTCCAG
--Y--S--T--A--Y--L--P--G-----------S--S--H--C--K--P--E--A--P--S--P--C--S--L--P--Q--S--N--P--R--L--Q-

----------------------------------------------------------------------------------------------------
-G--E--L--L--P--T--Y--T--H--Y--L--P--P--G--S--P--T--P--Y--N--P--P--L--A--G--A--P--M--P--L--T--H--L--
GGGGAACTGCTGCCCACCTATACCCACTACCTGCCCCCTGGCTCTCCCACTCCATACAACCCTCCCCTTGCTGGTGCCCCCATGCCCCTAACCCACCTCT
:: ::.::::: ::: ::::.: :: .::::..::::: ::::::::::::...::.:::::::::::. : :: :::::.:::::.:::::::::::::
GGTGAGCTGCTTCCCCCCTACAGCCCTTACCCACCCCCAGGCTCTCCCACTTTGTATAACCCTCCCCTCTCAGGGGCCCCTATGCCTCTAACCCACCTCT
-G--E--L--L--P--P--Y--S--P--Y--P--P--P--G--S--P--T--L--Y--N--P--P--L--S--G--A--P--M--P--L--T--H--L--

->
*-
AA
::
AA
*-

Pig Consensus Sequence

>BGISUST0000890609
ATGGCGCTACCCGGCTCCTCTCAGGATCAGGCCTGGAGCCTGGAGCCTCCCACTCCCGCGGCCCCGACCTCCGCATCCTCGGGCTCCCAGGAGCGGGAGG
GCGCCGGGAGCCCAGTGGTCTCCGGGGGGCTTCCCTTGGAGAAGGTGAAGCGGCCCATGAACGCGTTCATGGTGTGGAGCTCCGCCCAGCGCCGCCAGAT
GGCGCAGCAGAACCCGAAGATGCACAACTCCGAGATCTCCAAGCGCCTGGGCGCGCAGTGGAAGCTGCTGGGCGAGGACGAGAAGCGGCCCTTCGTGGAG
GAGGCTAAGCGGCTCCGGGCCCGGCACCTGCGCGACTACCCCGACTACAAGTACCGGCCCCGGCGCAAGACCAAGACCTCGGGGGCCGGGTCAGCCCACT
TCGGCCAGGGAAGCAGCGGTGTGGCTGGCGGCGGGCCGGTCTGGGGGCCCGGGTACGCGACTAACCAGGGGAGCAGAGGCTTTGGGTACCAGCCCCCCAA
CTACTCGACAGCCTACCTGCCTGGC---------TCTTCCCACTGTAAACCGGAGGCCCCTTCGCCGTGCTCCCTCCCTCAGAGTAACCCCAGGCTCCAG
GGTGAGCTGCTTCCCCCCTACAGCCCTTACCCACCCCCAGGCTCTCCCACTTTGTATAACCCTCCCCTCTCAGGGGCCCCTATGCCTCTAACCCACCTCT
AA


>BGISUSP0000890609
MALPGSSQDQAWSLEPPTPAAPTSASSGSQEREGAGSPVVSGGLPLEKVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKRLGAQWKLLGEDEKRPFVE
EAKRLRARHLRDYPDYKYRPRRKTKTSGAGSAHFGQGSSGVAGGGPVWGPGYATNQGSRGFGYQPPNYSTAYLPG---SSHCKPEAPSPCSLPQSNPRLQ
GELLPPYSPYPPPGSPTLYNPPLSGAPMPLTHL*