Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000013523 (click for geneview)
Transcript ID ENST00000251089(link to ensembl)
Symbol KIAA0759
Localtion Chromosome:14:76323341:76348983:-1 band: 14q24.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------><-----------------------------------
-M--I--A--S--C--L--C--Y--L--L--L--P--A--T--R--L--F--R--A--L--S--D--A--F--F--T--C--R--K--N--V--L--L--
ATGATCGCGTCGTGCTTGTGTTACCTGCTGCTGCCGGCCACGCGCCTCTTCCGCGCCCTCTCAGATGCTTTCTTCACATGTCGAAAAAATGTCCTTCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--N--S--S--S--P--Q--V--E--G--D--F--A--M--A--P--R--G--P--E--Q--E--E--C--E--G--L--L--Q--Q--W--R--E--E
CGAACAGCTCATCCCCCCAGGTAGAGGGCGACTTTGCCATGGCCCCTCGGGGCCCTGAGCAGGAGGAATGTGAGGGCCTGCTGCAGCAGTGGCGAGAAGA
                                                                                ::::::::::::::::::::
--------------------------------------------------------------------------------CTGCAGCAGTGGCGAGAAGA
---------------------------------------------------------------------------------L--Q--Q--W--R--E--E

----------------------------------------------------------------------------------------------------
--G--L--S--Q--V--L--S--T--A--S--E--G--P--L--I--D--K--G--L--A--Q--S--S--L--A--L--L--M--D--N--P--G--E-
AGGGTTGAGCCAGGTGCTCTCAACTGCAAGTGAGGGGCCCCTTATAGATAAAGGACTAGCCCAGAGCAGCCTGGCACTTCTGATGGATAATCCTGGAGAA
:::::.::::::::::::::::::::..:.:::::: ::::::.::::::. :::::::::::::::::::::::.::.:::::::::::::::::::::
AGGGTCGAGCCAGGTGCTCTCAACTGTGAATGAGGGTCCCCTTGTAGATAG-GGACTAGCCCAGAGCAGCCTGGCGCTCCTGATGGATAATCCTGGAGAA
--G--S--S--Q--V--L--S--T--V--N--E--G--P--L--V--D--K--G--L--A--Q--S--S--L--A--L--L--M--D--N--P--G--E-

----------------------------------------------------------------------------------------------------
-E--N--A--A--S--E--D--R--W--S--S--R--Q--L--S--D--L--R--A--A--E--N--L--D--E--P--F--P--E--M--L--G--E--
GAGAATGCTGCTTCAGAGGACAGGTGGTCCAGCAGGCAGCTGAGTGACCTTCGGGCTGCAGAGAACCTGGATGAGCCTTTCCCTGAGATGCTAGGAGAGG
 ::.::::::::::::::::::.::::::::.:::::::::::::::.:::::::: ::::::::::::::.:::::::::::.:::.::.:::::::::
CAGGATGCTGCTTCAGAGGACAAGTGGTCCAACAGGCAGCTGAGTGATCTTCGGGCGGCAGAGAACCTGGACGAGCCTTTCCCCGAGGTGTTAGGAGAGG
-Q--D--A--A--S--E--D--K--W--S--N--R--Q--L--S--D--L--R--A--A--E--N--L--D--E--P--F--P--E--V--L--G--E--

----------------------------------------------------------------------------------------------------
E--P--L--L--E--V--E--G--V--E--G--S--M--W--A--A--I--P--M--Q--S--E--P--Q--Y--A--D--C--A--A--L--P--V--G
AGCCACTGCTGGAGGTGGAGGGGGTGGAGGGCTCCATGTGGGCAGCTATCCCCATGCAGTCGGAGCCCCAGTATGCAGACTGTGCTGCCCTCCCAGTGGG
:::::::::..:::         :: ::::::.: ::::::::: ::.::::..::::: : :.  ::: ::::::::::::.::::.:::::::.::::
AGCCACTGCCAGAG---------GTCGAGGGCCCAATGTGGGCACCTGTCCCTGTGCAGACTGGCGCCCCGTATGCAGACTGCGCTGTCCTCCCAATGGG
E--P--L--P--E-----------V--E--G--P--M--W--A--P--V--P--V--Q--T--G--A--P--Y--A--D--C--A--V--L--P--M--G

----------------------------------------------------------------------------------------------------
--A--L--A--T--E--Q--W--E--E--D--P--A--V--L--A--W--S--I--A--P--E--P--V--P--Q--E--E--A--S--I--W--P--F-
TGCCCTGGCCACAGAGCAGTGGGAAGAGGACCCAGCGGTGTTGGCCTGGAGCATAGCACCTGAGCCTGTGCCCCAGGAAGAGGCTTCCATCTGGCCCTTT
::::::::::.:::::::::::::::::::::: ::.::: ::::::::::::::::::: ::::::::::::::::::::::::.::::::::::::::
TGCCCTGGCCGCAGAGCAGTGGGAAGAGGACCCTGCAGTGGTGGCCTGGAGCATAGCACCGGAGCCTGTGCCCCAGGAAGAGGCTCCCATCTGGCCCTTT
--A--L--A--A--E--Q--W--E--E--D--P--A--V--V--A--W--S--I--A--P--E--P--V--P--Q--E--E--A--P--I--W--P--F-

---------------------------------------------------><-----------------------------------------------
-E--G--L--G--Q--L--Q--P--P--A--V--E--I--P--Y--H--E--I--L--W--R--E--W--E--D--F--S--T--Q--P--D--A--Q--
GAGGGCCTGGGGCAGTTGCAGCCTCCCGCAGTGGAAATACCATATCATGAAATTTTGTGGCGAGAATGGGAGGATTTCTCCACCCAGCCAGATGCTCAGG
::::::::::::::::::::.:::::: ::.::::::: :::::::::            :::::::::::.:::::::::::.::::::::::::::::
GAGGGCCTGGGGCAGTTGCAACCTCCCCCAATGGAAATCCCATATCAT------------CGAGAATGGGAAGATTTCTCCACTCAGCCAGATGCTCAGG
-E--G--L--G--Q--L--Q--P--P--P--M--E--I--P--Y--H--------------R--E--W--E--D--F--S--T--Q--P--D--A--Q--

----------------------------------------------------------------------------------------------------
G--L--K--A--G--D--G--P--Q--F--Q--F--T--L--M--S--Y--N--I--L--A--Q--D--L--M--Q--Q--S--S--E--L--Y--L--H
GCCTGAAGGCAGGAGATGGCCCTCAGTTCCAGTTCACTCTGATGTCTTATAACATCCTGGCTCAGGACCTGATGCAGCAGAGCTCAGAGCTCTATCTACA
:::::.:::::::.:::::::::::::::::::::::::: :::::.::::::::::::::.:::::::::::::::::::::::.:::::::::::.::
GCCTGGAGGCAGGGGATGGCCCTCAGTTCCAGTTCACTCTCATGTCCTATAACATCCTGGCCCAGGACCTGATGCAGCAGAGCTCGGAGCTCTATCTGCA
G--L--E--A--G--D--G--P--Q--F--Q--F--T--L--M--S--Y--N--I--L--A--Q--D--L--M--Q--Q--S--S--E--L--Y--L--H

------------------------------------------------------------------------------><--------------------
--C--H--P--D--I--L--N--W--N--Y--R--F--V--N--L--M--Q--E--F--Q--H--W--D--P--D--I--L--C--L--Q--E--V--Q-
TTGCCATCCAGACATCCTCAATTGGAACTATCGCTTCGTGAACCTCATGCAGGAATTCCAGCACTGGGACCCTGATATCCTGTGTCTCCAGGAAGTCCAG
::::::.:::::::::::::::::::::::::::::.:.:::.:::::::::::::::::::::::::::::.::::::.::::::::::::::::::::
TTGCCACCCAGACATCCTCAATTGGAACTATCGCTTTGCGAATCTCATGCAGGAATTCCAGCACTGGGACCCCGATATCTTGTGTCTCCAGGAAGTCCAG
--C--H--P--D--I--L--N--W--N--Y--R--F--A--N--L--M--Q--E--F--Q--H--W--D--P--D--I--L--C--L--Q--E--V--Q-

------------------------------------------------><--------------------------------------------------
-E--D--H--Y--W--E--Q--L--E--P--S--L--R--M--M--G--F--T--C--F--Y--K--R--R--T--G--C--K--T--D--G--C--A--
GAAGATCATTACTGGGAGCAGCTGGAACCCTCTCTGCGAATGATGGGCTTTACCTGTTTCTACAAGAGGAGGACTGGGTGTAAAACCGATGGCTGTGCTG
::::::::::::::::::::::::::.::::::::: ::::::::   ::::::::::::::::::::::::::.::::::::.:: :::::::::::::
GAAGATCATTACTGGGAGCAGCTGGAGCCCTCTCTGAGAATGATG---TTTACCTGTTTCTACAAGAGGAGGACCGGGTGTAAGACAGATGGCTGTGCTG
-E--D--H--Y--W--E--Q--L--E--P--S--L--R--M--M-----F--T--C--F--Y--K--R--R--T--G--C--K--T--D--G--C--A--

----------------------------------------------------------------------------------------------------
V--C--Y--K--P--T--R--F--R--L--L--C--A--S--P--V--E--Y--F--R--P--G--L--E--L--L--N--R--D--N--V--G--L--V
TCTGCTACAAGCCTACCAGATTCCGCCTGCTCTGTGCTAGCCCTGTGGAGTACTTCCGGCCTGGCTTGGAGCTACTTAATCGGGATAATGTGGGCTTAGT
:::::::::::::.:: :::::::::::::::::.::.:::::.:::::.:::::.::::::::::.:::::: :.: :::::::.::.:::::::::::
TCTGCTACAAGCCCACGAGATTCCGCCTGCTCTGCGCCAGCCCCGTGGAATACTTTCGGCCTGGCTCGGAGCTCCCTCATCGGGACAACGTGGGCTTAGT
V--C--Y--K--P--T--R--F--R--L--L--C--A--S--P--V--E--Y--F--R--P--G--S--E--L--P--H--R--D--N--V--G--L--V

----------------------------------------------------------------------------------------------------
--L--L--L--Q--P--L--V--P--E--G--L--G--Q--V--S--V--A--P--L--C--V--A--N--T--H--I--L--Y--N--P--R--R--G-
GTTGCTACTGCAACCACTCGTCCCAGAAGGCCTGGGACAAGTCTCGGTGGCCCCGCTGTGTGTGGCAAATACCCATATCCTTTACAACCCACGCCGGGGC
:.::::.:::::.::::::::::::::::::::::::::::::::.:::::::: .:.::::::::::::::::::.:::: ::::::::::::::::::
GCTGCTGCTGCAGCCACTCGTCCCAGAAGGCCTGGGACAAGTCTCAGTGGCCCCTTTATGTGTGGCAAATACCCATGTCCTGTACAACCCACGCCGGGGC
--L--L--L--Q--P--L--V--P--E--G--L--G--Q--V--S--V--A--P--L--C--V--A--N--T--H--V--L--Y--N--P--R--R--G-

----------------------------------------------------------------------------------------------------
-D--V--K--L--A--Q--M--A--I--L--L--A--E--V--D--K--V--A--R--L--S--D--G--S--H--C--P--I--I--L--C--G--D--
GATGTCAAGCTGGCCCAGATGGCCATTCTCCTGGCGGAAGTGGACAAGGTGGCCAGACTGTCAGATGGCAGCCACTGCCCCATCATCTTGTGCGGGGACC
::::::::::::::::::::::::::::::.:::: ::::::::::::::::::::..:::: :::::::::::::::::::::::::::::::::::::
GATGTCAAGCTGGCCCAGATGGCCATTCTCTTGGCCGAAGTGGACAAGGTGGCCAGGTTGTCTGATGGCAGCCACTGCCCCATCATCTTGTGCGGGGACC
-D--V--K--L--A--Q--M--A--I--L--L--A--E--V--D--K--V--A--R--L--S--D--G--S--H--C--P--I--I--L--C--G--D--

----------------------------------------------------------------------------------><----------------
L--N--S--V--P--D--S--P--L--Y--N--F--I--R--D--G--E--L--Q--Y--H--G--M--P--A--W--K--V--S--G--Q--E--D--F
TAAATTCTGTCCCTGATTCACCTCTCTACAACTTCATCAGGGATGGAGAGCTCCAGTACCATGGGATGCCAGCCTGGAAGGTATCTGGACAGGAAGACTT
:.:::::::::::::::::::::::.:::::::::::::.:::::::::.::::::::::::::::::::::::::::::::::::::::::::.:::::
TGAATTCTGTCCCTGATTCACCTCTTTACAACTTCATCAAGGATGGAGAACTCCAGTACCATGGGATGCCAGCCTGGAAGGTATCTGGACAGGAGGACTT
L--N--S--V--P--D--S--P--L--Y--N--F--I--K--D--G--E--L--Q--Y--H--G--M--P--A--W--K--V--S--G--Q--E--D--F

----------------------------------------------------------------------------------------------------
--S--H--Q--L--Y--Q--R--K--L--Q--A--P--L--W--P--S--S--L--G--I--T--D--C--C--Q--Y--V--T--S--C--H--P--K-
CTCCCATCAGCTTTACCAGAGGAAGCTGCAGGCCCCACTGTGGCCCAGCTCCCTGGGCATCACTGATTGCTGTCAGTATGTCACCTCCTGTCACCCCAAG
:::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::
CTCCCATCAGCTTTACCAGAGGAAGCTGCAGGCCCCACTGTGGCCCAGCTCTCTGGGCATCACTGATTGCTGTCAGTATGTCACCTCCTGTCACCCCAAG
--S--H--Q--L--Y--Q--R--K--L--Q--A--P--L--W--P--S--S--L--G--I--T--D--C--C--Q--Y--V--T--S--C--H--P--K-

---------><-----------------------------------------------------------------------------------------
-R--S--E--R--R--K--Y--G--R--D--F--L--L--R--F--R--F--C--S--I--A--C--Q--R--P--V--G--L--V--L--M--E--G--
AGATCAGAGAGACGCAAGTATGGCCGAGACTTCCTGCTACGTTTCCGCTTCTGCAGCATCGCTTGTCAGCGACCAGTAGGACTGGTCCTTATGGAAGGAG
::::::   :::::.::.::..:::::::::::::::::::::::::::::::::.::::::.::::::::::: .::::::::::.:::::::::::::
AGATCA---AGACGTAAATACAGCCGAGACTTCCTGCTACGTTTCCGCTTCTGCAACATCGCCTGTCAGCGACCTATAGGACTGGTTCTTATGGAAGGAG
-R--S-----R--R--K--Y--S--R--D--F--L--L--R--F--R--F--C--N--I--A--C--Q--R--P--I--G--L--V--L--M--E--G--

--------------------><--------------------------------------------------------------------><--------
V--T--D--T--K--P--E--R--P--A--G--W--A--E--S--V--L--E--E--D--A--S--E--L--E--P--A--F--S--R--T--V--G--T
TGACAGATACTAAGCCAGAGCGACCTGCGGGTTGGGCTGAGTCTGTCCTTGAGGAAGATGCATCGGAGCTTGAGCCTGCCTTCTCCAGGACTGTAGGTAC
:::::::::. ::::::                                                                        ::::::::.::
TGACAGATATGAAGCCA------------------------------------------------------------------------ACTGTAGGCAC
V--T--D--M--K--P--------------------------------------------------------------------------T--V--G--T

----------------------------------------------------------------------------------------------------
--I--Q--H--C--L--H--L--T--S--V--Y--T--H--F--L--P--Q--R--G--R--P--E--V--T--T--M--P--L--G--L--G--M--T-
CATCCAGCACTGCCTCCACCTGACGTCAGTATATACCCACTTCCTGCCCCAGCGTGGCCGCCCAGAGGTCACTACAATGCCATTGGGTCTTGGAATGACA
:::::::::::::::::.:::::: ::.::.:::::.::.:::::::::::::.::::::::::::::::::.:::::::: :::::::::::::.::::
CATCCAGCACTGCCTCCGCCTGACCTCGGTGTATACTCATTTCCTGCCCCAGCATGGCCGCCCAGAGGTCACCACAATGCCCTTGGGTCTTGGAACGACA
--I--Q--H--C--L--R--L--T--S--V--Y--T--H--F--L--P--Q--H--G--R--P--E--V--T--T--M--P--L--G--L--G--T--T-

------------------------------------------------------><--------------------------------------------
-V--D--Y--I--F--F--S--A--E--S--C--E--N--G--N--R--T--D--H--R--L--Y--R--D--G--T--L--K--L--L--G--R--L--
GTAGATTACATCTTCTTCTCAGCTGAGTCCTGTGAGAATGGGAACAGAACTGATCACAGGCTGTATCGAGATGGAACTCTCAAGCTCCTGGGTCGTCTCT
::.::::::::::::::::::::.::::::::.::::::::::::::::::   ..:::::: ::::..:::::.::::::::::: :::::.:::::::
GTGGATTACATCTTCTTCTCAGCCGAGTCCTGCGAGAATGGGAACAGAACT---TGCAGGCTCTATCAGGATGGGACTCTCAAGCTGCTGGGCCGTCTCT
-V--D--Y--I--F--F--S--A--E--S--C--E--N--G--N--R--T-----C--R--L--Y--Q--D--G--T--L--K--L--L--G--R--L--

----------------------------------------------------------------------------------------------------
S--L--L--S--E--E--I--L--W--A--A--N--G--L--P--N--P--F--C--S--S--D--H--L--C--L--L--A--S--F--G--M--E--V
CCCTTCTCTCTGAAGAGATACTCTGGGCTGCCAATGGCTTACCCAACCCCTTCTGCTCTTCAGACCACCTCTGCCTGCTAGCCAGCTTCGGGATGGAAGT
::::.:::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::::::::::::::::::::
CCCTCCTCTCTGAAGAGATTCTCTGGGCTGCCAATGGCTTACCCAACCCCTTCTGCTCTTCAGACCACCTCTGCCTACTGGCCAGCTTCGGGATGGAAGT
S--L--L--S--E--E--I--L--W--A--A--N--G--L--P--N--P--F--C--S--S--D--H--L--C--L--L--A--S--F--G--M--E--V

-------------
--T--A--P--*-
CACCGCCCCATGA
:::::::::::::
CACCGCCCCATGA
--T--A--P--*-

Pig Consensus Sequence

>BGISUST0000881818
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------CTGCAGCAGTGGCGAGAAGA
AGGGTCGAGCCAGGTGCTCTCAACTGTGAATGAGGGTCCCCTTGTAGAtgGACTAGCCCAGAGCAGCCTGGCGCTCCTGATGGATAATCCTGGAGAACAG
GATGCTGCTTCAGAGGACAAGTGGTCCAACAGGCAGCTGAGTGATCTTCGGGCGGCAGAGAACCTGGACGAGCCTTTCCCCGAGGTGTTAGGAGAGGAGC
CACTGCCAGAGGTCGAGGGCCCAATGTGGGCACCTGTCCCTGTGCAGACTGGCGCCCCGTATGCAGACTGCGCTGTCCTCCCAATGGGTGCCCTGGCCGC
AGAGCAGTGGGAAGAGGACCCTGCAGTGGTGGCCTGGAGCATAGCACCGGAGCCTGTGCCCCAGGAAGAGGCTCCCATCTGGCCCTTTGAGGGCCTGGGG
CAGTTGCAACCTCCCCCAATGGAAATCCCATATCAT------------CGAGAATGGGAAGATTTCTCCACTCAGCCAGATGCTCAGGGCCTGGAGGCAG
GGGATGGCCCTCAGTTCCAGTTCACTCTCATGTCCTATAACATCCTGGCCCAGGACCTGATGCAGCAGAGCTCGGAGCTCTATCTGCATTGCCACCCAGA
CATCCTCAATTGGAACTATCGCTTTGCGAATCTCATGCAGGAATTCCAGCACTGGGACCCCGATATCTTGTGTCTCCAGGAAGTCCAGGAAGATCATTAC
TGGGAGCAGCTGGAGCCCTCTCTGAGAATGATG---TTTACCTGTTTCTACAAGAGGAGGACCGGGTGTAAGACAGATGGCTGTGCTGTCTGCTACAAGC
CCACGAGATTCCGCCTGCTCTGCGCCAGCCCCGTGGAATACTTTCGGCCTGGCTCGGAGCTCCCTCATCGGGACAACGTGGGCTTAGTGCTGCTGCTGCA
GCCACTCGTCCCAGAAGGCCTGGGACAAGTCTCAGTGGCCCCTTTATGTGTGGCAAATACCCATGTCCTGTACAACCCACGCCGGGGCGATGTCAAGCTG
GCCCAGATGGCCATTCTCTTGGCCGAAGTGGACAAGGTGGCCAGGTTGTCTGATGGCAGCCACTGCCCCATCATCTTGTGCGGGGACCTGAATTCTGTCC
CTGATTCACCTCTTTACAACTTCATCAAGGATGGAGAACTCCAGTACCATGGGATGCCAGCCTGGAAGGTATCTGGACAGGAGGACTTCTCCCATCAGCT
TTACCAGAGGAAGCTGCAGGCCCCACTGTGGCCCAGCTCTCTGGGCATCACTGATTGCTGTCAGTATGTCACCTCCTGTCACCCCAAGAGATCA---AGA
CGTAAATACAGCCGAGACTTCCTGCTACGTTTCCGCTTCTGCAACATCGCCTGTCAGCGACCTATAGGACTGGTTCTTATGGAAGGAGTGACAGATATGA
AGCCA------------------------------------------------------------------------ACTGTAGGCACCATCCAGCACTG
CCTCCGCCTGACCTCGGTGTATACTCATTTCCTGCCCCAGCATGGCCGCCCAGAGGTCACCACAATGCCCTTGGGTCTTGGAACGACAGTGGATTACATC
TTCTTCTCAGCCGAGTCCTGCGAGAATGGGAACAGAACT---TGCAGGCTCTATCAGGATGGGACTCTCAAGCTGCTGGGCCGTCTCTCCCTCCTCTCTG
AAGAGATTCTCTGGGCTGCCAATGGCTTACCCAACCCCTTCTGCTCTTCAGACCACCTCTGCCTACTGGCCAGCTTCGGGATGGAAGTCACCGCCCCATG
A


>BGISUSP0000881818
------------------------------------------------------------LQQWREEGSSQVLSTVNEGPLVDGLAQSSLALLMDNPGEQ
DAASEDKWSNRQLSDLRAAENLDEPFPEVLGEEPLPEVEGPMWAPVPVQTGAPYADCAVLPMGALAAEQWEEDPAVVAWSIAPEPVPQEEAPIWPFEGLG
QLQPPPMEIPYH----REWEDFSTQPDAQGLEAGDGPQFQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFANLMQEFQHWDPDILCLQEVQEDHY
WEQLEPSLRMM-FTCFYKRRTGCKTDGCAVCYKPTRFRLLCASPVEYFRPGSELPHRDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHVLYNPRRGDVKL
AQMAILLAEVDKVARLSDGSHCPIILCGDLNSVPDSPLYNFIKDGELQYHGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITDCCQYVTSCHPKRS-R
RKYSRDFLLRFRFCNIACQRPIGLVLMEGVTDMKP------------------------TVGTIQHCLRLTSVYTHFLPQHGRPEVTTMPLGLGTTVDYI
FFSAESCENGNRT-CRLYQDGTLKLLGRLSLLSEEILWAANGLPNPFCSSDHLCLLASFGMEVTAP*