Sequences
EST Library Info
fhi2Unavailable
mga1Mammary gland - 7 days after weaning
nco2Newborn 115 days, colon
pfco1Unavailable
ret2Retina
ste1M. Semitendinosus
tes1Testes
tra1Trachea
uio4Unavailable
vin2M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000104047 (click for geneview)
Transcript ID ENST00000251250(link to ensembl)
Symbol NP_064619.2
Localtion Chromosome:15:47700588:47723153:1 band: 15q21.2
Description x 009 protein
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--L--N--P--P--I--F--L--K--R--S--E--E--N--S--S--K--F--V--E--T--K--Q--S--Q--T--T--S--I--A--S--E--
ATGTCTCTCAATCCACCTATATTTCTCAAACGAAGTGAAGAAAATAGTTCAAAATTTGTGGAAACAAAACAGTCACAAACTACTTCCATAGCTTCAGAAG
:::::.:: ::: ::: ::::::::::::: .::: ::::::.: :.:::::::::::::::::.: :::::::::::::::::::::::::: ::::::
ATGTCCCTGAATACACATATATTTCTCAAAGAAAGGGAAGAAGAGAATTCAAAATTTGTGGAAATACAACAGTCACAAACTACTTCCATAGCTGCAGAAG
-M--S--L--N--T--H--I--F--L--K--E--R--E--E--E--N--S--K--F--V--E--I--Q--Q--S--Q--T--T--S--I--A--A--E--

----------------------------------------------------------------------------------------------------
D--P--L--Q--N--L--C--L--A--S--Q--E--V--L--Q--K--A--Q--Q--S--G--R--S--K--C--L--K--C--G--G--S--R--M--F
ATCCCCTTCAAAACTTATGTTTAGCATCTCAAGAAGTTCTTCAAAAAGCTCAGCAAAGTGGGAGATCAAAATGTCTCAAATGTGGTGGTTCCAGAATGTT
::::.::::::::::::::.:::::::::::::::::::::::::::::::::::::.:::.::::::::::::::.::.::::::::::: ::::::::
ATCCTCTTCAAAACTTATGCTTAGCATCTCAAGAAGTTCTTCAAAAAGCTCAGCAAAATGGAAGATCAAAATGTCTTAAGTGTGGTGGTTCAAGAATGTT
D--P--L--Q--N--L--C--L--A--S--Q--E--V--L--Q--K--A--Q--Q--N--G--R--S--K--C--L--K--C--G--G--S--R--M--F

---------------------------------------------------------------><-----------------------------------
--Y--C--Y--T--C--Y--V--P--V--E--N--V--P--I--E--Q--I--P--L--V--K--L--P--L--K--I--D--I--I--K--H--P--N-
CTACTGCTATACATGTTATGTTCCAGTTGAAAATGTACCTATTGAACAGATTCCACTTGTGAAGCTTCCATTGAAGATTGACATCATTAAACATCCAAAT
.::::::::::: ::::::::.::::::::.::::::::::.::::::::: :::: :::.:::::::::::::::::::::::::::::.:::::.:::
TTACTGCTATACCTGTTATGTCCCAGTTGAGAATGTACCTACTGAACAGATACCACATGTAAAGCTTCCATTGAAGATTGACATCATTAAGCATCCGAAT
--Y--C--Y--T--C--Y--V--P--V--E--N--V--P--T--E--Q--I--P--H--V--K--L--P--L--K--I--D--I--I--K--H--P--N-

----------------------------------------------------------------------------------------------------
-E--T--D--G--K--S--T--A--I--H--A--K--L--L--A--P--E--F--V--N--I--Y--T--Y--P--C--I--P--E--Y--E--E--K--
GAAACAGATGGCAAAAGTACTGCTATACATGCAAAACTCTTAGCACCTGAATTTGTAAACATTTACACGTATCCGTGTATTCCAGAATATGAAGAAAAGG
:::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.:::::.::.::::: :::::::::::::::::::::::::
GAAACAGATGGCAAAAGCACTGCTATACATGCAAAACTCTTAGCACCTGAATTTGTAAATATTTATACATATCCTTGTATTCCAGAATATGAAGAAAAGG
-E--T--D--G--K--S--T--A--I--H--A--K--L--L--A--P--E--F--V--N--I--Y--T--Y--P--C--I--P--E--Y--E--E--K--

-------><-------------------------------------------------------------------------------------------
D--H--E--V--A--L--I--F--P--G--P--Q--S--I--S--I--K--D--I--S--F--H--L--Q--K--R--I--Q--N--N--V--R--G--K
ACCATGAAGTTGCACTCATTTTTCCTGGACCTCAGTCTATCTCAATAAAAGATATTTCTTTTCATCTGCAAAAAAGGATTCAAAATAATGTTAGAGGCAA
::::::::::::::::..:::::::::::::: .::::.:::::.::::::::::::::::::::::::::::: ::::: :::::..:::::::.:: .
ACCATGAAGTTGCACTTGTTTTTCCTGGACCTAGGTCTGTCTCAGTAAAAGATATTTCTTTTCATCTGCAAAAACGGATTGAAAATGGTGTTAGAAGCCG
D--H--E--V--A--L--V--F--P--G--P--R--S--V--S--V--K--D--I--S--F--H--L--Q--K--R--I--E--N--G--V--R--S--R

----------------------------------------------------------------------------------------------------
--N--D--D--P--D--K--P--S--F--K--R--K--R--T--E--E--Q--E--F--C--D--L--N--D--S--K--C--K--G--T--T--L--K-
AAATGATGACCCTGACAAGCCATCTTTTAAACGCAAAAGAACTGAAGAACAAGAGTTCTGTGATTTGAATGACAGCAAGTGCAAAGGCACAACACTGAAA
:::::::::::.::::::::::::. ::::::::::.:.::::::::::::.         :::::::::::.:.:::::::::::. ::: ::::.:::
AAATGATGACCTTGACAAGCCATCCATTAAACGCAAGAAAACTGAAGAACAG---------GATTTGAATGATAACAAGTGCAAAGAGACACCACTAAAA
--N--D--D--L--D--K--P--S--I--K--R--K--K--T--E--E--Q-----------D--L--N--D--N--K--C--K--E--T--P--L--K-

------------------------------------------------------------------><--------------------------------
-K--I--I--F--I--D--S--T--W--N--Q--T--N--K--I--F--T--D--E--R--L--Q--G--L--L--Q--V--E--L--K--T--R--K--
AAAATTATATTTATAGATAGCACCTGGAACCAAACAAACAAAATATTCACTGATGAGCGACTTCAAGGGTTGTTACAAGTTGAGTTGAAAACAAGAAAAA
::::::.::::::::::.::.::::::::::::::::::::::::::: :::::::: ::::::::   :::.:::::::.:::::::::::::::::::
AAAATTGTATTTATAGACAGTACCTGGAACCAAACAAACAAAATATTCTCTGATGAGAGACTTCAA---TTGCTACAAGTCGAGTTGAAAACAAGAAAAA
-K--I--V--F--I--D--S--T--W--N--Q--T--N--K--I--F--S--D--E--R--L--Q-----L--L--Q--V--E--L--K--T--R--K--

----------------------------------------------------------------------------------------------------
T--C--F--W--R--H--Q--K--G--K--P--D--T--F--L--S--T--I--E--A--I--Y--Y--F--L--V--D--Y--H--T--D--I--L--K
CTTGCTTTTGGCGCCATCAAAAAGGAAAGCCAGATACTTTCCTTTCTACAATTGAAGCCATTTACTACTTTCTGGTAGACTACCATACTGATATATTAAA
:::::::::::::::::::.:::::::::::::::::.::::::::.:::::::::::::::::::::::::::::::::::.:::::::::.:::::::
CTTGCTTTTGGCGCCATCAGAAAGGAAAGCCAGATACCTTCCTTTCCACAATTGAAGCCATTTACTACTTTCTGGTAGACTATCATACTGATGTATTAAA
T--C--F--W--R--H--Q--K--G--K--P--D--T--F--L--S--T--I--E--A--I--Y--Y--F--L--V--D--Y--H--T--D--V--L--K

----------------------------------------------------------------------------------------------------
--E--K--Y--R--G--Q--Y--D--N--L--L--F--F--Y--S--F--M--Y--Q--L--I--K--N--A--K--C--S--G--D--K--E--T--G-
AGAGAAATACAGAGGGCAATATGACAATCTTTTATTTTTCTATTCTTTTATGTACCAGTTGATAAAGAATGCCAAATGCTCTGGAGATAAGGAAACAGGA
:::::::::::.:::.:::::.::.:::::::::::::::::.:::::::::.::::::::::::::::::::::: ::.:::::::.:::::::::.::
AGAGAAATACAAAGGACAATACGATAATCTTTTATTTTTCTACTCTTTTATGCACCAGTTGATAAAGAATGCCAAAAGCCCTGGAGACAAGGAAACAAGA
--E--K--Y--K--G--Q--Y--D--N--L--L--F--F--Y--S--F--M--H--Q--L--I--K--N--A--K--S--P--G--D--K--E--T--R-

-------------->
-K--L--T--H--*-
AAACTTACACATTAG
::: :::: ::::::
AAAATTACCCATTAG
-K--I--T--H--*-

Pig Consensus Sequence

>BGISUST0000898057
ATGTCCCTGAATACACATATATTTCTCAAAGAAAGGGAAGAAGAGAATTCAAAATTTGTGGAAATACAACAGTCACAAACTACTTCCATAGCTGCAGAAG
ATCCTCTTCAAAACTTATGCTTAGCATCTCAAGAAGTTCTTCAAAAAGCTCAGCAAAATGGAAGATCAAAATGTCTTAAGTGTGGTGGTTCAAGAATGTT
TTACTGCTATACCTGTTATGTCCCAGTTGAGAATGTACCTACTGAACAGATACCACATGTAAAGCTTCCATTGAAGATTGACATCATTAAGCATCCGAAT
GAAACAGATGGCAAAAGCACTGCTATACATGCAAAACTCTTAGCACCTGAATTTGTAAATATTTATACATATCCTTGTATTCCAGAATATGAAGAAAAGG
ACCATGAAGTTGCACTTGTTTTTCCTGGACCTAGGTCTGTCTCAGTAAAAGATATTTCTTTTCATCTGCAAAAACGGATTGAAAATGGTGTTAGAAGCCG
AAATGATGACCTTGACAAGCCATCCATTAAACGCAAGAAAACTGAAGAACAGGATTTGAATGATAACAAGTGCAAAGAGACACCACTAAAAAAAATTGTA
TTTATAGACAGTACCTGGAACCAAACAAACAAAATATTCTCTGATGAGAGACTTCAA---TTGCTACAAGTCGAGTTGAAAACAAGAAAAACTTGCTTTT
GGCGCCATCAGAAAGGAAAGCCAGATACCTTCCTTTCCACAATTGAAGCCATTTACTACTTTCTGGTAGACTATCATACTGATGTATTAAAAGAGAAATA
CAAAGGACAATACGATAATCTTTTATTTTTCTACTCTTTTATGCACCAGTTGATAAAGAATGCCAAAAGCCCTGGAGACAAGGAAACAAGAAAAATTACC
CATTAG


>BGISUSP0000898057
MSLNTHIFLKEREEENSKFVEIQQSQTTSIAAEDPLQNLCLASQEVLQKAQQNGRSKCLKCGGSRMFYCYTCYVPVENVPTEQIPHVKLPLKIDIIKHPN
ETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALVFPGPRSVSVKDISFHLQKRIENGVRSRNDDLDKPSIKRKKTEEQDLNDNKCKETPLKKIV
FIDSTWNQTNKIFSDERLQ-LLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDVLKEKYKGQYDNLLFFYSFMHQLIKNAKSPGDKETRKIT
H*