Sequences
EST Library Info
cbl28Blood
cst2Stomach - RNA from China
jca3Joint capsule
lnt2Lymphatic nodule tracheobroncalis
lyg1Lymphatic gland
mcp3Mammae, collostrum producing
nco1Newborn 115 days, colon
sto4Stomach
tes1Testes
tra2Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000065135 (click for geneview)
Transcript ID ENST00000251336(link to ensembl)
Symbol GNAI3
Localtion Chromosome:1:109803343:109849017:1 band: 1p13.3
Description Guanine nucleotide-binding protein G(k), alpha subunit (G(i) alpha-3). [Source:Uniprot/SWISSPROT;Acc:P08754]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--C--T--L--S--A--E--D--K--A--A--V--E--R--S--K--M--I--D--R--N--L--R--E--D--G--E--K--A--A--K--E--
ATGGGCTGCACGTTGAGCGCCGAAGACAAGGCGGCAGTGGAGCGAAGCAAGATGATCGACCGCAACTTACGGGAGGACGGGGAAAAAGCGGCCAAAGAAG
:::::::::::::::::::::::::::::::::::.:::::.::.:::::::::::::::::::::::.::::::::.:::::.:::::::: :::::::
ATGGGCTGCACGTTGAGCGCCGAAGACAAGGCGGCGGTGGAACGGAGCAAGATGATCGACCGCAACTTGCGGGAGGATGGGGAGAAAGCGGCGAAAGAAG
-M--G--C--T--L--S--A--E--D--K--A--A--V--E--R--S--K--M--I--D--R--N--L--R--E--D--G--E--K--A--A--K--E--

-----------------><-----------------------------------------><--------------------------------------
V--K--L--L--L--L--G--A--G--E--S--G--K--S--T--I--V--K--Q--M--K--I--I--H--E--D--G--Y--S--E--D--E--C--K
TGAAGCTGCTGCTACTCGGTGCTGGAGAATCTGGTAAAAGCACCATTGTGAAACAGATGAAAATCATTCATGAGGATGGCTATTCAGAGGATGAATGTAA
::::::::::::::      ::::::::::::::::::::::::::.::::::::::::   ::::::::::::::::::::::::::::: ::::::::
TGAAGCTGCTGCTA------GCTGGAGAATCTGGTAAAAGCACCATCGTGAAACAGATG---ATCATTCATGAGGATGGCTATTCAGAGGAAGAATGTAA
V--K--L--L--L--------A--G--E--S--G--K--S--T--I--V--K--Q--M-----I--I--H--E--D--G--Y--S--E--E--E--C--K

----------------------------------------------------------------------------------------------------
--Q--Y--K--V--V--V--Y--S--N--T--I--Q--S--I--I--A--I--I--R--A--M--G--R--L--K--I--D--F--G--E--A--A--R-
ACAATATAAAGTAGTTGTCTACAGCAATACTATACAGTCCATCATTGCAATCATAAGAGCCATGGGACGGCTAAAGATTGACTTTGGGGAAGCTGCCAGG
::::::::::::.::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::.::::::::::::::::::::.
ACAATATAAAGTGGTTGTCTACAGCAATACTATACAGTCCATCATTGCAATCATTAGAGCCATGGGACGGCTAAAGATCGACTTTGGGGAAGCTGCCAGA
--Q--Y--K--V--V--V--Y--S--N--T--I--Q--S--I--I--A--I--I--R--A--M--G--R--L--K--I--D--F--G--E--A--A--R-

--><------------------------------------------------------------------------------------------------
-A--D--D--A--R--Q--L--F--V--L--A--G--S--A--E--E--G--V--M--T--P--E--L--A--G--V--I--K--R--L--W--R--D--
GCAGATGATGCCCGGCAATTATTTGTTTTAGCTGGCAGTGCTGAAGAAGGAGTCATGACTCCAGAACTAGCAGGAGTGATTAAACGGTTATGGCGAGATG
:::::.:::::.:::::.:::::::::::.::::::::::::::::::::.::.::::::::::::.::::::::::.::::::::::::::::::::::
GCAGACGATGCTCGGCAGTTATTTGTTTTGGCTGGCAGTGCTGAAGAAGGGGTTATGACTCCAGAATTAGCAGGAGTAATTAAACGGTTATGGCGAGATG
-A--D--D--A--R--Q--L--F--V--L--A--G--S--A--E--E--G--V--M--T--P--E--L--A--G--V--I--K--R--L--W--R--D--

------------------------------------------------------------><--------------------------------------
G--G--V--Q--A--C--F--S--R--S--R--E--Y--Q--L--N--D--S--A--S--Y--Y--L--N--D--L--D--R--I--S--Q--S--N--Y
GTGGGGTACAAGCTTGCTTCAGCAGATCCAGGGAATATCAGCTCAATGATTCTGCTTCATATTATCTAAATGATCTGGATAGAATATCCCAGTCTAACTA
:::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::   ::.:::::::::.::::::::::::::::. :.:::::
GTGGGGTGCAAGCTTGCTTCAGCAGATCCAGGGAATATCAGCTCAATGATTCTGCTTCA---TACCTAAATGATTTGGATAGAATATCCCAAACCAACTA
G--G--V--Q--A--C--F--S--R--S--R--E--Y--Q--L--N--D--S--A--S-----Y--L--N--D--L--D--R--I--S--Q--T--N--Y

-----------------------------------------------------------------------------------------><---------
--I--P--T--Q--Q--D--V--L--R--T--R--V--K--T--T--G--I--V--E--T--H--F--T--F--K--D--L--Y--F--K--M--F--D-
CATTCCAACTCAGCAAGATGTTCTTCGGACGAGAGTGAAGACCACAGGCATTGTAGAAACACATTTCACCTTCAAAGACCTATACTTCAAGATGTTTGAT
:::::::::::::::::::::.:: :::::.:::::::::::::::::::::::.::.:::::.:::::.:::::::::::.::::::   :::::::::
CATTCCAACTCAGCAAGATGTCCTGCGGACAAGAGTGAAGACCACAGGCATTGTGGAGACACACTTCACTTTCAAAGACCTGTACTTC---ATGTTTGAT
--I--P--T--Q--Q--D--V--L--R--T--R--V--K--T--T--G--I--V--E--T--H--F--T--F--K--D--L--Y--F-----M--F--D-

----------------------------------------------------------------------------------------------------
-V--G--G--Q--R--S--E--R--K--K--W--I--H--C--F--E--G--V--T--A--I--I--F--C--V--A--L--S--D--Y--D--L--V--
GTAGGTGGCCAAAGATCAGAACGAAAAAAGTGGATTCACTGTTTTGAGGGAGTGACAGCAATTATCTTCTGTGTGGCCCTCAGTGATTATGACCTTGTTC
::::::::::::::::::::::::::.:::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::: :
GTAGGTGGCCAAAGATCAGAACGAAAGAAGTGGATTCACTGTTTTGAGGGAGTTACAGCAATTATCTTCTGTGTGGCCCTCAGTGATTATGACCTTGTAC
-V--G--G--Q--R--S--E--R--K--K--W--I--H--C--F--E--G--V--T--A--I--I--F--C--V--A--L--S--D--Y--D--L--V--

-------------------><-------------------------------------------------------------------------------
L--A--E--D--E--E--M--N--R--M--H--E--S--M--K--L--F--D--S--I--C--N--N--K--W--F--T--E--T--S--I--I--L--F
TGGCTGAGGACGAGGAGATGAACCGAATGCATGAAAGCATGAAACTGTTTGACAGCATTTGTAATAACAAATGGTTTACAGAAACTTCAATCATTCTCTT
::::::::::.::::::::::::::::::::::::::::::::::::::.::::::::::::::.::.:::::::::::::: ::::: :::::::: ::
TGGCTGAGGATGAGGAGATGAACCGAATGCATGAAAGCATGAAACTGTTCGACAGCATTTGTAACAATAAATGGTTTACAGACACTTCCATCATTCTGTT
L--A--E--D--E--E--M--N--R--M--H--E--S--M--K--L--F--D--S--I--C--N--N--K--W--F--T--D--T--S--I--I--L--F

-------------------------------------------------------------------------><-------------------------
--L--N--K--K--D--L--F--E--E--K--I--K--R--S--P--L--T--I--C--Y--P--E--Y--T--G--S--N--T--Y--E--E--A--A-
CCTTAACAAGAAAGACCTTTTTGAGGAAAAAATAAAGAGGAGTCCGTTAACTATCTGTTATCCAGAATACACAGGTTCCAATACATATGAAGAGGCAGCT
:::.:::::::::::.:::::::::::.:::::::::::::::::.:::::::::::::::::::::::::::   :::::::::::::::::.::::::
CCTCAACAAGAAAGATCTTTTTGAGGAGAAAATAAAGAGGAGTCCATTAACTATCTGTTATCCAGAATACACA---TCCAATACATATGAAGAAGCAGCT
--L--N--K--K--D--L--F--E--E--K--I--K--R--S--P--L--T--I--C--Y--P--E--Y--T-----S--N--T--Y--E--E--A--A-

----------------------------------------------------------------------------------------------------
-A--Y--I--Q--C--Q--F--E--D--L--N--R--R--K--D--T--K--E--I--Y--T--H--F--T--C--A--T--D--T--K--N--V--Q--
GCCTATATTCAATGCCAGTTTGAAGATCTGAACAGAAGAAAAGATACCAAGGAGATCTATACTCACTTCACCTGTGCCACAGACACGAAGAATGTGCAGT
::.::.:::::.::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::: :::::.:::::::
GCTTACATTCAGTGCCAGTTTGAAGATCTGAACAGAAGAAAAGATACCAAGGAGATCTATACCCACTTCACCTGTGCCACAGACACCAAGAACGTGCAGT
-A--Y--I--Q--C--Q--F--E--D--L--N--R--R--K--D--T--K--E--I--Y--T--H--F--T--C--A--T--D--T--K--N--V--Q--

---------------------------------------------------------------->
F--V--F--D--A--V--T--D--V--I--I--K--N--N--L--K--E--C--G--L--Y--*-
TTGTTTTTGATGCTGTTACAGATGTCATCATTAAAAACAACTTAAAGGAATGTGGACTTTATTGA
::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.::::::
TTGTTTTTGATGCTGTTACAGATGTCATCATTAAAAACAACTTAAAAGAATGTGGACTCTATTGA
F--V--F--D--A--V--T--D--V--I--I--K--N--N--L--K--E--C--G--L--Y--*-

Pig Consensus Sequence

>BGISUST0000882430
ATGGGCTGCACGTTGAGCGCCGAAGACAAGGCGGCGGTGGAACGGAGCAAGATGATCGACCGCAACTTGCGGGAGGATGGGGAGAAAGCGGCGAAAGAAG
TGAAGCTGCTGCTA------GCTGGAGAATCTGGTAAAAGCACCATCGTGAAACAGATG---ATCATTCATGAGGATGGCTATTCAGAGGAAGAATGTAA
ACAATATAAAGTGGTTGTCTACAGCAATACTATACAGTCCATCATTGCAATCATTAGAGCCATGGGACGGCTAAAGATCGACTTTGGGGAAGCTGCCAGA
GCAGACGATGCTCGGCAGTTATTTGTTTTGGCTGGCAGTGCTGAAGAAGGGGTTATGACTCCAGAATTAGCAGGAGTAATTAAACGGTTATGGCGAGATG
GTGGGGTGCAAGCTTGCTTCAGCAGATCCAGGGAATATCAGCTCAATGATTCTGCTTCA---TACCTAAATGATTTGGATAGAATATCCCAAACCAACTA
CATTCCAACTCAGCAAGATGTCCTGCGGACAAGAGTGAAGACCACAGGCATTGTGGAGACACACTTCACTTTCAAAGACCTGTACTTC---ATGTTTGAT
GTAGGTGGCCAAAGATCAGAACGAAAGAAGTGGATTCACTGTTTTGAGGGAGTTACAGCAATTATCTTCTGTGTGGCCCTCAGTGATTATGACCTTGTAC
TGGCTGAGGATGAGGAGATGAACCGAATGCATGAAAGCATGAAACTGTTCGACAGCATTTGTAACAATAAATGGTTTACAGACACTTCCATCATTCTGTT
CCTCAACAAGAAAGATCTTTTTGAGGAGAAAATAAAGAGGAGTCCATTAACTATCTGTTATCCAGAATACACA---TCCAATACATATGAAGAAGCAGCT
GCTTACATTCAGTGCCAGTTTGAAGATCTGAACAGAAGAAAAGATACCAAGGAGATCTATACCCACTTCACCTGTGCCACAGACACCAAGAACGTGCAGT
TTGTTTTTGATGCTGTTACAGATGTCATCATTAAAAACAACTTAAAAGAATGTGGACTCTATTGA


>BGISUSP0000882430
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLL--AGESGKSTIVKQM-IIHEDGYSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAAR
ADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSAS-YLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKDLYF-MFD
VGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYT-SNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY*