Sequences
EST Library Info
nep1Newborn 115 days, epidermis
pgl2Pituitary gland
Clusters
Oligos
SNPs

Gene ID ENSG00000087116 (click for geneview)
Transcript ID ENST00000251582(link to ensembl)
Symbol ADAMTS2
Localtion Chromosome:5:178473474:178704935:-1 band: 5q35.3
Description ADAMTS-2 precursor (EC 3.4.24.14) (A disintegrin and metalloproteinase with thrombospondin motifs 2) (ADAM-TS 2) (ADAM-TS2) (Procollagen I/II amino-propeptide processing enzyme) (Procollagen I N-proteinase) (PC I-NP) (Procollagen N-endopeptidase) (pNPI). [Source:Uniprot/SWISSPROT;Acc:O95450]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--P--P--A--G--A--A--R--R--L--L--C--P--A--L--L--L--L--L--L--L--L--P--P--P--L--L--P--P--P--P--P--
ATGGATCCGCCGGCGGGAGCCGCTCGCCGCCTGCTCTGCCCCGCGCTGCTGCTGCTGCTGCTGCTGCTGCCGCCGCCGCTCCTGCCGCCGCCGCCGCCGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------><------------------------------------------------------------
P--A--N--A--R--L--A--A--A--A--D--P--P--G--G--P--L--G--H--G--A--E--R--I--L--A--V--P--V--R--T--D--A--Q
CCGCGAACGCCAGGCTCGCCGCCGCCGCCGACCCCCCAGGCGGGCCCCTGGGGCACGGAGCGGAGCGCATCCTGGCGGTGCCCGTGCGCACTGACGCCCA
                                         ::::::.:::::::::::::::::::::::::::::::::: :::::::::::::::::
-----------------------------------------GGGCCCTTGGGGCACGGAGCGGAGCGCATCCTGGCGGTGCCGGTGCGCACTGACGCCCA
------------------------------------------G--P--L--G--H--G--A--E--R--I--L--A--V--P--V--R--T--D--A--Q

----------------------------------------------------------------------------------------------------
--G--R--L--V--S--H--V--V--S--A--A--T--S--R--A--G--V--R--A--R--R--A--A--P--V--R--T--P--S--F--P--G--G-
GGGCCGCTTGGTGTCCCACGTGGTGTCGGCAGCTACGTCCAGAGCAGGGGTACGAGCCCGCAGGGCCGCCCCGGTCCGGACCCCGAGCTTCCCCGGAGGC
:: :::::::::.:::::::::::::: ::.:: .:: :: ..:: ::::::::.:::::::::::::::::.::::. ::::::.::::.::.::::::
GGTCCGCTTGGTATCCCACGTGGTGTCCGCGGCGGCGGCCCAGGCTGGGGTACGGGCCCGCAGGGCCGCCCCAGTCCACACCCCGGGCTTTCCTGGAGGC
--V--R--L--V--S--H--V--V--S--A--A--A--A--Q--A--G--V--R--A--R--R--A--A--P--V--H--T--P--G--F--P--G--G-

----------------------------------------------------------------------------------------------------
-N--E--E--E--P--G--S--H--L--F--Y--N--V--T--V--F--G--R--D--L--H--L--R--L--R--P--N--A--R--L--V--A--P--
AACGAGGAGGAGCCTGGCAGTCACCTCTTCTACAATGTCACGGTCTTTGGCCGAGACCTGCACCTGCGGCTGCGGCCCAACGCCCGCCTCGTGGCGCCCG
:..:::::::: ::::::.:.:.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:
AGTGAGGAGGACCCTGGCGGCCGCCTCTTCTACAATGTCACGGTCTTTGGCCGAGACCTGCACCTGCGGCTGCGGCCCAACGCCCGCCTCGTGGCGCCTG
-S--E--E--D--P--G--G--R--L--F--Y--N--V--T--V--F--G--R--D--L--H--L--R--L--R--P--N--A--R--L--V--A--P--

----------------------------------------------------------------------------------------------------
G--A--T--M--E--W--Q--G--E--K--G--T--T--R--V--E--P--L--L--G--S--C--L--Y--V--G--D--V--A--G--L--A--E--A
GGGCCACTATGGAGTGGCAGGGCGAGAAGGGCACCACCCGCGTGGAGCCCCTGCTCGGGAGCTGTCTCTACGTCGGAGACGTGGCCGGCCTAGCCGAAGC
::::::: .:::::::::::::::::  ::: .::::::::::::::::::::::.:::: :::.::::::::::::::::::::::::::.::.:::.:
GGGCCACGGTGGAGTGGCAGGGCGAGTCGGGAGCCACCCGCGTGGAGCCCCTGCTTGGGACCTGCCTCTACGTCGGAGACGTGGCCGGCCTGGCTGAAAC
G--A--T--V--E--W--Q--G--E--S--G--A--T--R--V--E--P--L--L--G--T--C--L--Y--V--G--D--V--A--G--L--A--E--T

---------------------------------><-----------------------------------------------------------------
--S--S--V--A--L--S--N--C--D--G--L--A--G--L--I--R--M--E--E--E--E--F--F--I--E--P--L--E--K--G--L--A--A-
CTCCTCTGTGGCGCTCAGCAACTGCGATGGGCTGGCTGGTCTGATCCGGATGGAGGAGGAGGAGTTCTTCATCGAACCCTTGGAGAAGGGGCTGGCGGCG
::::::.::::::::::::::::::::.:::::::::::.:::::::: ::::: :::::::::::::::::.::.:::.:::::::.:::::::::: :
CTCCTCCGTGGCGCTCAGCAACTGCGACGGGCTGGCTGGCCTGATCCGTATGGACGAGGAGGAGTTCTTCATTGAGCCCCTGGAGAAAGGGCTGGCGGAG
--S--S--V--A--L--S--N--C--D--G--L--A--G--L--I--R--M--D--E--E--E--F--F--I--E--P--L--E--K--G--L--A--E-

---------------------------------------------------------------------------------------------><-----
-Q--E--A--E--Q--G--R--V--H--V--V--Y--R--R--P--P--T--S--------P--P--L--G--G--P--Q--A--L--D--T--G--A--
CAGGAGGCTGAGCAAGGCCGTGTGCATGTGGTGTATCGCCGGCCACCCACGTCC------CCTCCTCTCGGGGGGCCACAGGCCCTGGACACAGGGGCCT
 :::::::.:::::.:::::.:::::::::::::::::::::::.::::: :::      :::::::: :::::.::::::::::::::::::   :::.
AAGGAGGCCGAGCAGGGCCGCGTGCATGTGGTGTATCGCCGGCCGCCCACCTCCAGACCCCCTCCTCTGGGGGGACCACAGGCCCTGGACACA---GCCC
-K--E--A--E--Q--G--R--V--H--V--V--Y--R--R--P--P--T--S--R--P--P--P--L--G--G--P--Q--A--L--D--T-----A--

----------------------------------------------------------------------------------------------------
S--L--D--S--L--D--S--L--S--R--A--L--G--V--L--E--E--H--A--N--S--S--R--R--R--A--R--R--H--A--A--D--D--D
CCCTGGACAGCCTGGACAGCCTCAGCCGCGCCCTGGGCGTCCTAGAGGAGCACGCCAACAGCTCGAGGCGGAGGGCACGCAGGCATGCTGCGGACGATGA
:::..: ::::::::::::::::::::. :::::::::.::::.::::::::::.::::::::: ::::::::::::::::::::.::::: :::::.::
CCCCAGCCAGCCTGGACAGCCTCAGCCAAGCCCTGGGCATCCTGGAGGAGCACGTCAACAGCTCCAGGCGGAGGGCACGCAGGCACGCTGCCGACGACGA
P--P--A--S--L--D--S--L--S--Q--A--L--G--I--L--E--E--H--V--N--S--S--R--R--R--A--R--R--H--A--A--D--D--D

------------------------------------------------------------------------------------------------><--
--Y--N--I--E--V--L--L--G--V--D--D--S--V--V--Q--F--H--G--K--E--H--V--Q--K--Y--L--L--T--L--M--N--I--V-
CTACAACATCGAGGTCCTGCTGGGCGTGGATGACTCTGTGGTGCAGTTCCACGGGAAGGAGCACGTACAGAAGTACCTGCTGACACTCATGAACATTGTC
:::::::::::::::::::::::: :::::.::::::::::: :::::::::::::::::::::::.:::::::::::::: :: :::::::::      
CTACAACATCGAGGTCCTGCTGGGGGTGGACGACTCTGTGGTCCAGTTCCACGGGAAGGAGCACGTGCAGAAGTACCTGCTCACTCTCATGAAC------
--Y--N--I--E--V--L--L--G--V--D--D--S--V--V--Q--F--H--G--K--E--H--V--Q--K--Y--L--L--T--L--M--N-------

--------------------------------------------------------------------------------><------------------
-N--E--I--Y--H--D--E--S--L--G--A--H--I--N--V--V--L--V--R--I--I--L--L--S--Y--G--K--S--M--S--L--I--E--
AATGAAATCTACCATGACGAGTCCTTGGGTGCCCACATCAACGTGGTCCTGGTGCGGATCATCCTCCTGAGCTATGGAAAGTCCATGAGCCTCATCGAGA
                                                                                 ::::::::::::::.::::
---------------------------------------------------------------------------------TCCATGAGCCTCATTGAGA
----------------------------------------------------------------------------------S--M--S--L--I--E--

----------------------------------------------------------------------------------------------------
I--G--N--P--S--Q--S--L--E--N--V--C--R--W--A--Y--L--Q--Q--K--P--D--T--G--H--D--E--Y--H--D--H--A--I--F
TCGGGAACCCCTCTCAGAGCCTGGAGAATGTCTGCCGCTGGGCCTACCTCCAGCAGAAGCCAGACACGGGCCACGATGAATACCACGATCACGCCATCTT
::::.::::::::::::::.::::::::.:::::::::::::::::::: :::::::::::.::::: :::::::: ::.:::::::::::.:::::.::
TCGGAAACCCCTCTCAGAGTCTGGAGAACGTCTGCCGCTGGGCCTACCTGCAGCAGAAGCCGGACACTGGCCACGAGGAGTACCACGATCATGCCATTTT
I--G--N--P--S--Q--S--L--E--N--V--C--R--W--A--Y--L--Q--Q--K--P--D--T--G--H--E--E--Y--H--D--H--A--I--F

-------------------------------------><-------------------------------------------------------------
--L--T--R--Q--D--F--G--P--S--G--M--Q--G--Y--A--P--V--T--G--M--C--H--P--V--R--S--C--T--L--N--H--E--D-
CCTCACACGGCAGGACTTTGGGCCTTCCGGCATGCAAGGCTATGCTCCTGTCACCGGCATGTGCCATCCGGTCCGCAGCTGCACCCTGAACCATGAGGAC
:::::: :::::::::::::::::.:: :::::::::   ::::::::::::::::: ::::::::.:: :::::::::::::::::::::::.:::::.
CCTCACCCGGCAGGACTTTGGGCCCTCGGGCATGCAA---TATGCTCCTGTCACCGGGATGTGCCACCCTGTCCGCAGCTGCACCCTGAACCACGAGGAT
--L--T--R--Q--D--F--G--P--S--G--M--Q-----Y--A--P--V--T--G--M--C--H--P--V--R--S--C--T--L--N--H--E--D-

-------------------------------------------><-------------------------------------------------------
-G--F--S--S--A--F--V--V--A--H--E--T--G--H--V--L--G--M--E--H--D--G--Q--G--N--R--C--G--D--E--V--R--L--
GGCTTCTCCTCAGCGTTTGTGGTGGCCCATGAGACTGGCCACGTGCTGGGCATGGAGCACGACGGGCAGGGCAACCGCTGTGGCGACGAGGTGCGGCTGG
:::::::::::::::::.:::::::::::::::::::::      ::::::::::::::.::::::::::::::::::::.:::::::::::::::::::
GGCTTCTCCTCAGCGTTCGTGGTGGCCCATGAGACTGGC------CTGGGCATGGAGCATGACGGGCAGGGCAACCGCTGCGGCGACGAGGTGCGGCTGG
-G--F--S--S--A--F--V--V--A--H--E--T--G--------L--G--M--E--H--D--G--Q--G--N--R--C--G--D--E--V--R--L--

---------------------------------------------------------------------------------------><-----------
G--S--I--M--A--P--L--V--Q--A--A--F--H--R--F--H--W--S--R--C--S--Q--Q--E--L--S--R--Y--L--H--S--Y--D--C
GCAGCATCATGGCGCCCCTGGTGCAGGCCGCCTTCCACCGCTTCCACTGGTCCCGCTGCAGCCAGCAGGAGCTGAGCCGCTACCTGCACTCCTATGACTG
:::::::::::::.:: ::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::
GCAGCATCATGGCACCGCTGGTGCAGGCAGCCTTCCACCGCTTCCACTGGTCCCGCTGCAGCCAGCAGGAGCTGAGCCGCTACCTG---TCCTATGACTG
G--S--I--M--A--P--L--V--Q--A--A--F--H--R--F--H--W--S--R--C--S--Q--Q--E--L--S--R--Y--L-----S--Y--D--C

----------------------------------------------------------------------------------------------------
--L--L--D--D--P--F--A--H--D--W--P--A--L--P--Q--L--P--G--L--H--Y--S--M--N--E--Q--C--R--F--D--F--G--L-
CCTGCTGGATGACCCCTTCGCCCACGACTGGCCGGCGCTGCCCCAGCTCCCGGGACTGCACTACTCCATGAACGAGCAATGCCGCTTTGACTTCGGCCTG
::::: .:::::::::::::::::.:::::::::::::::::::::::::: ::.:::::::::::::::::::::::.::::::::.::::::::::::
CCTGCGAGATGACCCCTTCGCCCATGACTGGCCGGCGCTGCCCCAGCTCCCTGGGCTGCACTACTCCATGAACGAGCAGTGCCGCTTCGACTTCGGCCTG
--L--R--D--D--P--F--A--H--D--W--P--A--L--P--Q--L--P--G--L--H--Y--S--M--N--E--Q--C--R--F--D--F--G--L-

--------------------><------------------------------------------------------------------------------
-G--Y--M--M--C--T--A--F--R--T--F--D--P--C--K--Q--L--W--C--S--H--P--D--N--P--Y--F--C--K--T--K--K--G--
GGCTACATGATGTGCACGGCGTTCCGGACCTTTGACCCCTGCAAGCAGCTGTGGTGCAGCCATCCTGACAACCCCTACTTTTGCAAGACCAAGAAGGGGC
::::::::::::::::: :::::.::::::::.:::::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::::
GGCTACATGATGTGCACTGCGTTTCGGACCTTCGACCCCTGCAAGCAGCTGTGGTGCAGCCACCCTGATAACCCCTACTTTTGCAAGACCAAGAAGGGGC
-G--Y--M--M--C--T--A--F--R--T--F--D--P--C--K--Q--L--W--C--S--H--P--D--N--P--Y--F--C--K--T--K--K--G--

----------------------------------><----------------------------------------------------------------
P--P--L--D--G--T--M--C--A--P--G--K--H--C--F--K--G--H--C--I--W--L--T--P--D--I--L--K--R--D--G--S--W--G
CCCCCTTGGACGGGACTATGTGTGCACCTGGCAAGCATTGTTTTAAAGGACACTGCATCTGGCTGACACCTGACATCCTCAAACGGGACGGCAGCTGGGG
::::..::::::::::.::::::::::::::::::::.::.::::::::::::::::::::::::::::::::::::::::::::.:::::::.::::::
CCCCTCTGGACGGGACCATGTGTGCACCTGGCAAGCACTGCTTTAAAGGACACTGCATCTGGCTGACACCTGACATCCTCAAACGAGACGGCAACTGGGG
P--P--L--D--G--T--M--C--A--P--G--K--H--C--F--K--G--H--C--I--W--L--T--P--D--I--L--K--R--D--G--N--W--G

--------------------------------------------------------------------------------><------------------
--A--W--S--P--F--G--S--C--S--R--T--C--G--T--G--V--K--F--R--T--R--Q--C--D--N--P--H--P--A--N--G--G--R-
CGCTTGGAGTCCGTTTGGCTCCTGCTCACGTACCTGTGGCACGGGCGTGAAGTTCAGGACCCGCCAGTGTGACAACCCACACCCGGCCAACGGGGGCCGC
:::.:::::::: ::.::::::::::: ::.:::                                                ::.:::::.::.::::::
CGCCTGGAGTCCCTTCGGCTCCTGCTCCCGCACC------------------------------------------------CCAGCCAATGGAGGCCGC
--A--W--S--P--F--G--S--C--S--R--T--------------------------------------------------P--A--N--G--G--R-

----------------------------------------------------------------------------------------------------
-T--C--S--G--L--A--Y--D--F-----Q--L--C--S--R--Q--D--C--P--D--S--L--A--D--F--R--E--E--Q--C--R--Q--W--
ACCTGCTCGGGCCTTGCCTACGACTTC---CAGCTCTGCAGCCGCCAGGACTGCCCCGACTCCCTGGCTGACTTCCGCGAGGAGCAGTGCCGCCAGTGGG
:::::.::.::::::::::::::.:::     ::::::::.:. ::::::::::::.::: :::::::.::::::::::::::::::::::: :::::::
ACCTGTTCAGGCCTTGCCTACGATTTCC--ATGCTCTGCAACTCCCAGGACTGCCCTGACGCCCTGGCCGACTTCCGCGAGGAGCAGTGCCGACAGTGGG
-T--C--S--G--L--A--Y--D--F--\--Q--L--C--N--S--Q--D--C--P--D--A--L--A--D--F--R--E--E--Q--C--R--Q--W--

-----------------------------------------------------------><---------------------------------------
D--L--Y--F--E--H--G--D--A--Q--H--H--W--L--P--H--E--H--R--D--A--K--E--R--C--H--L--Y--C--E--S--R--E--T
ACCTGTACTTCGAGCACGGCGACGCCCAGCACCACTGGCTGCCCCACGAGCACCGGGATGCCAAGGAGAGATGCCACCTGTACTGCGAGTCCAGGGAGAC
:::::::::::::::::::.:::::::::::::::::::: ::::::::::::::::::   ::::::::::::::::: :::::::::::::.::::::
ACCTGTACTTCGAGCACGGTGACGCCCAGCACCACTGGCTTCCCCACGAGCACCGGGAT---AAGGAGAGATGCCACCTCTACTGCGAGTCCAAGGAGAC
D--L--Y--F--E--H--G--D--A--Q--H--H--W--L--P--H--E--H--R--D-----K--E--R--C--H--L--Y--C--E--S--K--E--T

---------------------------------------------------------------------------------------------><-----
--G--E--V--V--S--M--K--R--M--V--H--D--G--T--R--C--S--Y--K--D--A--F--S--L--C--V--R--G--D--C--R--K--V-
CGGGGAGGTGGTGTCCATGAAGCGCATGGTGCATGACGGGACGCGCTGCTCCTACAAGGACGCCTTCAGCCTCTGTGTGCGCGGGGACTGCAGGAAGGTG
.:::::::::::::::::::::::::::::.::.::.:: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGGGGAGGTGGTGTCCATGAAGCGCATGGTACACGATGGCACGCGCTGCTCCTACAAGGACGCCTTCAGCCTCTGTGTGCGCGGGGACTGCAGGAAGGTG
--G--E--V--V--S--M--K--R--M--V--H--D--G--T--R--C--S--Y--K--D--A--F--S--L--C--V--R--G--D--C--R--K--V-

----------------------------------------------------------------------------------------------------
-G--C--D--G--V--I--G--S--S--K--Q--E--D--K--C--G--V--C--G--G--D--N--S--H--C--K--V--V--K--G--T--F--T--
GGCTGTGACGGTGTGATCGGCTCCAGCAAGCAGGAAGACAAGTGTGGCGTGTGCGGAGGGGACAACAGCCACTGCAAAGTGGTCAAGGGCACGTTCACAC
::::::::::: :::::::::::::::::.:::::.::::::::::: :::::.:::::.::::::  :::::::::.:::::::::::::: ::::: :
GGCTGTGACGGGGTGATCGGCTCCAGCAAACAGGAGGACAAGTGTGGGGTGTGTGGAGGAGACAACTCCCACTGCAAGGTGGTCAAGGGCACTTTCACCC
-G--C--D--G--V--I--G--S--S--K--Q--E--D--K--C--G--V--C--G--G--D--N--S--H--C--K--V--V--K--G--T--F--T--

-----------------><-------------------------------------------------------------------------------><
R--S--P--K--K--H--G--Y--I--K--M--F--E--I--P--A--G--A--R--H--L--L--I--Q--E--V--D--A--T--S--H--H--L--A
GGTCACCCAAGAAGCATGGTTACATCAAGATGTTTGAGATCCCTGCAGGAGCCAGACACCTGCTCATTCAGGAGGTAGACGCCACCAGCCACCATCTGGC
:  :.:::::::::      ::::::::::::::.:::::::: ::.:::::::::::::::::.::.:::::::..:::.:::::::::::::.:::  
GCGCGCCCAAGAAG------TACATCAAGATGTTCGAGATCCCAGCGGGAGCCAGACACCTGCTTATCCAGGAGGCGGACACCACCAGCCACCACCTG--
R--A--P--K--K--------Y--I--K--M--F--E--I--P--A--G--A--R--H--L--L--I--Q--E--A--D--T--T--S--H--H--L---

----------------------------------------------------------------------------------------------------
--V--K--N--L--E--T--G--K--F--I--L--N--E--E--N--D--V--D--A--S--S--K--T--F--I--A--M--G--V--E--W--E--Y-
CGTCAAGAACCTGGAGACAGGCAAGTTCATCTTAAATGAAGAGAATGACGTGGATGCCAGTTCCAAAACCTTCATTGCCATGGGCGTGGAGTGGGAGTAC
 :::::::::.:::::::::::::::::::.:::::::::::::::::::::::: :::..:::::: :::::::.::::::::::::::.:::::::::
-GTCAAGAACTTGGAGACAGGCAAGTTCATTTTAAATGAAGAGAATGACGTGGATCCCAACTCCAAATCCTTCATCGCCATGGGCGTGGAATGGGAGTAC
--V--K--N--L--E--T--G--K--F--I--L--N--E--E--N--D--V--D--P--N--S--K--S--F--I--A--M--G--V--E--W--E--Y-

-----------------------------------------------------------------><---------------------------------
-R--D--E--D--G--R--E--T--L--Q--T--M--G--P--L--H--G--T--I--T--V--L--V--I--P--V--G--D--T--R--V--S--L--
AGAGACGAGGACGGCCGGGAGACGCTGCAGACCATGGGCCCCCTCCACGGCACCATCACCGTTCTGGTCATCCCGGTGGGAGACACCCGGGTCTCACTGA
 : :::::::::::::::::::::::::::::::.::::::::::::.::::::::::::::.::::::::::::  :::::::.:::::.::::.::::
CGCGACGAGGACGGCCGGGAGACGCTGCAGACCACGGGCCCCCTCCATGGCACCATCACCGTCCTGGTCATCCCGCAGGGAGACGCCCGGATCTCGCTGA
-R--D--E--D--G--R--E--T--L--Q--T--T--G--P--L--H--G--T--I--T--V--L--V--I--P--Q--G--D--A--R--I--S--L--

----------------------------------------------------------------------------------------------------
T--Y--K--Y--M--I--H--E--D--S--L--N--V--D--D--N--N--V--L--E--E--D--S--V--V--Y--E--W--A--L--K--K--W--S
CGTACAAATACATGATCCATGAGGACTCACTGAATGTCGACGACAACAACGTCCTGGAAGAGGACTCTGTGGTCTACGAGTGGGCCCTGAAGAAGTGGTC
: :::::::::::::::::.::::::::.:: ::::: ::::::::::::::::::::.:: :::::.:::: :::.:::::::::::::::::::::::
CCTACAAATACATGATCCACGAGGACTCGCTCAATGTGGACGACAACAACGTCCTGGAGGATGACTCCGTGGGCTATGAGTGGGCCCTGAAGAAGTGGTC
T--Y--K--Y--M--I--H--E--D--S--L--N--V--D--D--N--N--V--L--E--D--D--S--V--G--Y--E--W--A--L--K--K--W--S

-------------------------><-------------------------------------------------------------------------
--P--C--S--K--P--C--G--G--G--S--Q--F--T--K--Y--G--C--R--R--R--L--D--H--K--M--V--H--R--G--F--C--A--A-
TCCGTGCTCCAAGCCCTGTGGCGGAGGGTCCCAGTTCACCAAGTATGGCTGCCGCCGGAGGCTGGACCACAAGATGGTACACCGTGGCTTCTGTGCCGCC
::: ::::::::::::::.::.:::   ::::::::::::::::::::::::::::::::::::::::::::::::::.::::: :::::::::: .:::
TCCCTGCTCCAAGCCCTGCGGTGGA---TCCCAGTTCACCAAGTATGGCTGCCGCCGGAGGCTGGACCACAAGATGGTGCACCGAGGCTTCTGTGATGCC
--P--C--S--K--P--C--G--G-----S--Q--F--T--K--Y--G--C--R--R--R--L--D--H--K--M--V--H--R--G--F--C--D--A-

----------------------------------------------------------><----------------------------------------
-L--S--K--P--K--A--I--R--R--A--C--N--P--Q--E--C--S--Q--P--V--W--V--T--G--E--W--E--P--C--S--Q--T--C--
CTCTCGAAGCCCAAAGCCATCCGCAGAGCGTGCAACCCACAGGAATGCTCCCAGCCAGTGTGGGTCACAGGCGAATGGGAGCCATGTAGCCAGACCTGTG
:::::.                                                      ::::::::::::::.:::::::::::.::.:::: :::::
CTCTCA------------------------------------------------------TGGGTCACAGGCGAGTGGGAGCCATGCAGTCAGAGCTGTG
-L--S--------------------------------------------------------W--V--T--G--E--W--E--P--C--S--Q--S--C--

----------------------------------------------------------------------------------------------------
G--R--T--G--M--Q--V--R--S--V--R--C--I--Q--P--L--H--D--N--T--T--R--S--V--H--A--K--H--C--N--D--A--R--P
GGCGGACAGGCATGCAGGTGCGCTCCGTGCGCTGCATTCAGCCGCTACACGACAACACCACCCGCTCCGTGCACGCCAAGCACTGCAATGACGCCCGGCC
:::::::.:::::::::.. ::::::::::::::::: ::::: ::.:::.::::.::.:::::::::::::::.::::::::::::::::.:::::.::
GGCGGACGGGCATGCAGACTCGCTCCGTGCGCTGCATGCAGCCCCTGCACAACAATACTACCCGCTCCGTGCACACCAAGCACTGCAATGATGCCCGACC
G--R--T--G--M--Q--T--R--S--V--R--C--M--Q--P--L--H--N--N--T--T--R--S--V--H--T--K--H--C--N--D--A--R--P

------------------------------------------------------------------><--------------------------------
--E--S--R--R--A--C--S--R--E--L--C--P--G--R--W--R--A--G--P--W--S--Q--C--S--V--T--C--G--N--G--T--Q--E-
CGAGAGCCGCCGGGCCTGCAGCCGCGAGCTCTGCCCTGGTCGTTGGCGAGCCGGGCCCTGGTCCCAGTGCTCAGTAACCTGTGGCAACGGCACCCAGGAG
.:::.:::::::::::::::.:::.::::::::::::::::: :::::.::.::.:::::::::::::::::.:: :::::::::::::::::::::::.
TGAGGGCCGCCGGGCCTGCAACCGTGAGCTCTGCCCTGGTCGGTGGCGGGCTGGACCCTGGTCCCAGTGCTCGGTCACCTGTGGCAACGGCACCCAGGAA
--E--G--R--R--A--C--N--R--E--L--C--P--G--R--W--R--A--G--P--W--S--Q--C--S--V--T--C--G--N--G--T--Q--E-

--------------------------------------------------------------------------------------------------->
-R--P--V--L--C--R--T--A-----D--D--S--F--G--I--C--Q--E--E--R--P--E--T--A--R--T--C--R--L--G--P--C--P--
CGGCCAGTGCTCTGCCGCACCGCG---GACGACAGCTTCGGCATCTGCCAGGAGGAGCGTCCTGAGACAGCGAGGACCTGCAGGCTTGGCCCCTGTCCCC
::::: ::::::::::: ::: ::   :::.:::::::::: .::::::.::::::::: :::::::::::.::::.:::::::::::::::::::::: 
CGGCCTGTGCTCTGCCGAACCTCGT--GACAACAGCTTCGGGGTCTGCCGGGAGGAGCGGCCTGAGACAGCAAGGATCTGCAGGCTTGGCCCCTGTCCC-
-R--P--V--L--C--R--T--S--\--D--N--S--F--G--V--C--R--E--E--R--P--E--T--A--R--I--C--R--L--G--P--C--P--

<----------------------------------------------------------------------------------------><---------
R--N--I--S--D--P--S--K--K--S--Y--V--V--Q--W--L--S--R--P--D--P--D--S--P--I--R--K--I--S--S--K--G--H--C
GAAACATCTCAGATCCCTCCAAGAAGAGCTACGTAGTTCAGTGGCTGTCCCGCCCGGACCCCGACTCGCCCATCCGGAAGATCTCGTCAAAGGGCCACTG
  :::::::: ::.::::::::::::::::::::.:::::::::::::::                                          .:::::::
--AACATCTCTGACCCCTCCAAGAAGAGCTACGTGGTTCAGTGGCTGTCC------------------------------------------AGCCACTG
---N--I--S--D--P--S--K--K--S--Y--V--V--Q--W--L--S--------------------------------------------S--H--C

----------------------------------------------------------------------------------------------------
--Q--G--D--K--S--I--F--C--R--M--E--V--L--S--R--Y--C--S--I--P--G--Y--N--K--L--C--C--K--S--C--N--L--Y-
CCAAGGCGACAAGTCAATATTCTGTAGGATGGAAGTCTTGTCCCGCTATTGCTCCATCCCAGGCTACAACAAGCTGTGCTGCAAGTCCTGTAACCTGTAC
::::::::::::::::::.:::::::::::::::::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::::::.::
CCAAGGCGACAAGTCAATGTTCTGTAGGATGGAAGTCTTGTCTCGCTATTGCTCCATCCCAGGCTACAACAAACTGTGCTGCAAGTCCTGTAACCTGCAC
--Q--G--D--K--S--M--F--C--R--M--E--V--L--S--R--Y--C--S--I--P--G--Y--N--K--L--C--C--K--S--C--N--L--H-

----------------------------------------------------------------------------------------------------
-N--N--L--T--N--V--E--G--R-----I--E--P--P--P--G-----K--H--N--D--I--D--V--F--M--P--T--L--P--V--P--T--
AACAACCTCACCAACGTGGAGGGCAGG---ATAGAGCCACCGCCTGGG---AAGCACAACGACATTGACGTGTTCATGCCTACCCTCCCAGTGCCCACTG
.::::::::::..:.::::: ::: ::   ..::::::::: ::::     ::::::::.:::::.:: : ..::. :::.:::::::::::::::::: 
GACAACCTCACTGATGTGGATGGCTGGG--GCAGAGCCACCCCCTGT-GTGAAGCACAATGACATCGAAGAACTCGGGCCCACCCTCCCAGTGCCCACTC
-D--N--L--T--D--V--D--G--W--\--A--E--P--P--P--G--V--K--H--N--D--I--E--E--L--G--P--T--L--P--V--P--T--

----------------------------------------------------------------------------------------------------
V--A--M--E--V--R--P--S--P--S--T--P--L--E--V--P--L--N--A--S--S--T--N--A--T--E--D--H--P--E--T--N--A--V
TAGCCATGGAGGTGCGGCCATCACCAAGCACCCCCCTGGAGGTCCCTCTCAATGCCTCCAGCACCAATGCCACAGAGGATCACCCAGAAACCAATGCCGT
:::.:::::::::::.::: .:::: ::::: ::::::::::: :::::::::.:::::::::::::.:::::.:::::.::.:::::::::::.:: ::
TAGTCATGGAGGTGCAGCCTCCACCCAGCACGCCCCTGGAGGTGCCTCTCAATACCTCCAGCACCAACGCCACGGAGGACCATCCAGAAACCAACGCGGT
L--V--M--E--V--Q--P--P--P--S--T--P--L--E--V--P--L--N--T--S--S--T--N--A--T--E--D--H--P--E--T--N--A--V

----------------------------------------------------------------------------------------------------
--D--E--P--Y--K--I--H--G--L--E--D--E--V--Q--P--P--N--L--I--P--R--R--P--S--P--Y--E--K--T--R--N--Q--R-
AGATGAACCCTACAAAATCCATGGCCTGGAAGATGAAGTCCAGCCACCCAACCTAATCCCTCGACGACCGAGCCCCTATGAAAAGACCAGAAACCAAAGA
.::.: .::::::::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::.
GGACGTGCCCTACAAAATCCACGGCCTGGAAGACGAAGTCCAGCCACCCAACCTAATCCCTCGACGACCGAGCCCGTATGAAAAGACCAGAAACCAAAGG
--D--V--P--Y--K--I--H--G--L--E--D--E--V--Q--P--P--N--L--I--P--R--R--P--S--P--Y--E--K--T--R--N--Q--R-

------------------------------------------------------
-I--Q--E--L--I--D--E--M--R--K--K--E--M--L--G--K--F--*-
ATCCAAGAGCTCATTGATGAGATGCGGAAGAAAGAGATGCTCGGAAAGTTCTAA
:::::::::::::::::::::::: ::::::::::::::::::::::::: :::
ATCCAAGAGCTCATTGATGAGATGAGGAAGAAAGAGATGCTCGGAAAGTTATAA
-I--Q--E--L--I--D--E--M--R--K--K--E--M--L--G--K--L--*-

Pig Consensus Sequence

>BGISUST0000892252
----------------------------------------------------------------------------------------------------
-----------------------------------------GGGCCCTTGGGGCACGGAGCGGAGCGCATCCTGGCGGTGCCGGTGCGCACTGACGCCCA
GGTCCGCTTGGTATCCCACGTGGTGTCCGCGGCGGCGGCCCAGGCTGGGGTACGGGCCCGCAGGGCCGCCCCAGTCCACACCCCGGGCTTTCCTGGAGGC
AGTGAGGAGGACCCTGGCGGCCGCCTCTTCTACAATGTCACGGTCTTTGGCCGAGACCTGCACCTGCGGCTGCGGCCCAACGCCCGCCTCGTGGCGCCTG
GGGCCACGGTGGAGTGGCAGGGCGAGTCGGGAGCCACCCGCGTGGAGCCCCTGCTTGGGACCTGCCTCTACGTCGGAGACGTGGCCGGCCTGGCTGAAAC
CTCCTCCGTGGCGCTCAGCAACTGCGACGGGCTGGCTGGCCTGATCCGTATGGACGAGGAGGAGTTCTTCATTGAGCCCCTGGAGAAAGGGCTGGCGGAG
AAGGAGGCCGAGCAGGGCCGCGTGCATGTGGTGTATCGCCGGCCGCCCACCTCCAGACCCCCTCCTCTGGGGGGACCACAGGCCCTG---GCCCCCCCAG
CCAGCCTGGACAGCCTCAGCCAAGCCCTGGGCATCCTGGAGGAGCACGTCAACAGCTCCAGGCGGAGGGCACGCAGGCACGCTGCCGACGACGACTACAA
CATCGAGGTCCTGCTGGGGGTGGACGACTCTGTGGTCCAGTTCCACGGGAAGGAGCACGTGCAGAAGTACCTGCTCACTCTCATGAAC------------
---------------------------------------------------------------------------TCCATGAGCCTCATTGAGATCGGAA
ACCCCTCTCAGAGTCTGGAGAACGTCTGCCGCTGGGCCTACCTGCAGCAGAAGCCGGACACTGGCCACGAGGAGTACCACGATCATGCCATTTTCCTCAC
CCGGCAGGACTTTGGGCCCTCGGGCATGCAA---TATGCTCCTGTCACCGGGATGTGCCACCCTGTCCGCAGCTGCACCCTGAACCACGAGGATGGCTTC
TCCTCAGCGTTCGTGGTGGCCCATGAGACTGGC------CTGGGCATGGAGCATGACGGGCAGGGCAACCGCTGCGGCGACGAGGTGCGGCTGGGCAGCA
TCATGGCACCGCTGGTGCAGGCAGCCTTCCACCGCTTCCACTGGTCCCGCTGCAGCCAGCAGGAGCTGAGCCGCTACCTG---TCCTATGACTGCCTGCG
AGATGACCCCTTCGCCCATGACTGGCCGGCGCTGCCCCAGCTCCCTGGGCTGCACTACTCCATGAACGAGCAGTGCCGCTTCGACTTCGGCCTGGGCTAC
ATGATGTGCACTGCGTTTCGGACCTTCGACCCCTGCAAGCAGCTGTGGTGCAGCCACCCTGATAACCCCTACTTTTGCAAGACCAAGAAGGGGCCCCCTC
TGGACGGGACCATGTGTGCACCTGGCAAGCACTGCTTTAAAGGACACTGCATCTGGCTGACACCTGACATCCTCAAACGAGACGGCAACTGGGGCGCCTG
GAGTCCCTTCGGCTCCTGCTCCCGCACC------------------------------------------------CCAGCCAATGGAGGCCGCACCTGT
TCAGGCCTTGCCTACGATTTcaTGCTCTGCAACTCCCAGGACTGCCCTGACGCCCTGGCCGACTTCCGCGAGGAGCAGTGCCGACAGTGGGACCTGTACT
TCGAGCACGGTGACGCCCAGCACCACTGGCTTCCCCACGAGCACCGGGAT---AAGGAGAGATGCCACCTCTACTGCGAGTCCAAGGAGACTGGGGAGGT
GGTGTCCATGAAGCGCATGGTACACGATGGCACGCGCTGCTCCTACAAGGACGCCTTCAGCCTCTGTGTGCGCGGGGACTGCAGGAAGGTGGGCTGTGAC
GGGGTGATCGGCTCCAGCAAACAGGAGGACAAGTGTGGGGTGTGTGGAGGAGACAACTCCCACTGCAAGGTGGTCAAGGGCACTTTCACCCGCGCGCCCA
AGAAG------TACATCAAGATGTTCGAGATCCCAGCGGGAGCCAGACACCTGCTTATCCAGGAGGCGGACACCACCAGCCACCACCTG---GTCAAGAA
CTTGGAGACAGGCAAGTTCATTTTAAATGAAGAGAATGACGTGGATCCCAACTCCAAATCCTTCATCGCCATGGGCGTGGAATGGGAGTACCGCGACGAG
GACGGCCGGGAGACGCTGCAGACCACGGGCCCCCTCCATGGCACCATCACCGTCCTGGTCATCCCGCAGGGAGACGCCCGGATCTCGCTGACCTACAAAT
ACATGATCCACGAGGACTCGCTCAATGTGGACGACAACAACGTCCTGGAGGATGACTCCGTGGGCTATGAGTGGGCCCTGAAGAAGTGGTCTCCCTGCTC
CAAGCCCTGCGGTGGA---TCCCAGTTCACCAAGTATGGCTGCCGCCGGAGGCTGGACCACAAGATGGTGCACCGAGGCTTCTGTGATGCCCTCTCA---
---------------------------------------------------TGGGTCACAGGCGAGTGGGAGCCATGCAGTCAGAGCTGTGGGCGGACGG
GCATGCAGACTCGCTCCGTGCGCTGCATGCAGCCCCTGCACAACAATACTACCCGCTCCGTGCACACCAAGCACTGCAATGATGCCCGACCTGAGGGCCG
CCGGGCCTGCAACCGTGAGCTCTGCCCTGGTCGGTGGCGGGCTGGACCCTGGTCCCAGTGCTCGGTCACCTGTGGCAACGGCACCCAGGAACGGCCTGTG
CTCTGCCGAACCTCggACAACAGCTTCGGGGTCTGCCGGGAGGAGCGGCCTGAGACAGCAAGGATCTGCAGGCTTGGCCCCTGTCCC---AACATCTCTG
ACCCCTCCAAGAAGAGCTACGTGGTTCAGTGGCTGTCC------------------------------------------AGCCACTGCCAAGGCGACAA
GTCAATGTTCTGTAGGATGGAAGTCTTGTCTCGCTATTGCTCCATCCCAGGCTACAACAAACTGTGCTGCAAGTCCTGTAACCTGCACGACAACCTCACT
GATGTGGATGGCTGggCAGAGCCACCCCCtgTGAAGCACAATGACATCGAAGAACTCGGGCCCACCCTCCCAGTGCCCACTCTAGTCATGGAGGTGCAGC
CTCCACCCAGCACGCCCCTGGAGGTGCCTCTCAATACCTCCAGCACCAACGCCACGGAGGACCATCCAGAAACCAACGCGGTGGACGTGCCCTACAAAAT
CCACGGCCTGGAAGACGAAGTCCAGCCACCCAACCTAATCCCTCGACGACCGAGCCCGTATGAAAAGACCAGAAACCAAAGGATCCAAGAGCTCATTGAT
GAGATGAGGAAGAAAGAGATGCTCGGAAAGTTA


>BGISUSP0000892252
-----------------------------------------------GPLGHGAERILAVPVRTDAQVRLVSHVVSAAAAQAGVRARRAAPVHTPGFPGG
SEEDPGGRLFYNVTVFGRDLHLRLRPNARLVAPGATVEWQGESGATRVEPLLGTCLYVGDVAGLAETSSVALSNCDGLAGLIRMDEEEFFIEPLEKGLAE
KEAEQGRVHVVYRRPPTSRPPPLGGPQAL-APPASLDSLSQALGILEEHVNSSRRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMN----
-------------------------SMSLIEIGNPSQSLENVCRWAYLQQKPDTGHEEYHDHAIFLTRQDFGPSGMQ-YAPVTGMCHPVRSCTLNHEDGF
SSAFVVAHETG--LGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYL-SYDCLRDDPFAHDWPALPQLPGLHYSMNEQCRFDFGLGY
MMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKRDGNWGAWSPFGSCSRT----------------PANGGRTC
SGLAYDFMLCNSQDCPDALADFREEQCRQWDLYFEHGDAQHHWLPHEHRD-KERCHLYCESKETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCD
GVIGSSKQEDKCGVCGGDNSHCKVVKGTFTRAPKK--YIKMFEIPAGARHLLIQEADTTSHHL-VKNLETGKFILNEENDVDPNSKSFIAMGVEWEYRDE
DGRETLQTTGPLHGTITVLVIPQGDARISLTYKYMIHEDSLNVDDNNVLEDDSVGYEWALKKWSPCSKPCGG-SQFTKYGCRRRLDHKMVHRGFCDALS-
-----------------WVTGEWEPCSQSCGRTGMQTRSVRCMQPLHNNTTRSVHTKHCNDARPEGRRACNRELCPGRWRAGPWSQCSVTCGNGTQERPV
LCRTSDNSFGVCREERPETARICRLGPCP-NISDPSKKSYVVQWLS--------------SHCQGDKSMFCRMEVLSRYCSIPGYNKLCCKSCNLHDNLT
DVDGWAEPPPVKHNDIEELGPTLPVPTLVMEVQPPPSTPLEVPLNTSSTNATEDHPETNAVDVPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELID
EMRKKEMLGKL