Sequences
EST Library Info
spc2Spinal cord
Clusters
Oligos
SNPs

Gene ID ENSG00000110344 (click for geneview)
Transcript ID ENST00000252108(link to ensembl)
Symbol UBE4A
Localtion Chromosome:11:117735512:117775134:1 band: 11q23.3
Description Ubiquitin conjugation factor E4 A. [Source:Uniprot/SWISSPROT;Acc:Q14139]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--D--Q--E--N--N--N--N--I--S--S--N--P--F--A--A--L--F--G--S--L--A--D--A--K--Q--F--A--A--I--Q--K--
ATGACAGACCAGGAGAATAACAACAACATCTCAAGTAACCCCTTTGCTGCTCTTTTTGGCTCCCTGGCTGATGCCAAACAGTTTGCGGCAATCCAAAAAG
:::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.::.:::::.:::::::::::.:
ATGACAGACCAGGAGAATAACAACAACATTTCAAGTAACCCCTTTGCTGCTCTTTTTGGCTCCCTGGCTGATGCCAAGCAATTTGCAGCAATCCAAAAGG
-M--T--D--Q--E--N--N--N--N--I--S--S--N--P--F--A--A--L--F--G--S--L--A--D--A--K--Q--F--A--A--I--Q--K--

--------------------><------------------------------------------------------------------------------
E--Q--L--K--Q--Q--S--D--E--L--P--A--S--P--D--D--S--D--N--S--V--S--E--S--L--D--E--F--D--Y--S--V--A--E
AGCAGCTGAAGCAACAATCTGATGAACTCCCAGCTAGCCCAGATGACTCGGATAATAGCGTGTCAGAGAGCCTGGATGAATTCGATTACTCTGTGGCTGA
:::::::::::::.::.:::   :::::::::::.:::::.::::::::.::::::::.:::::::::::::::::::::::.::::::::.::::::::
AGCAGCTGAAGCAGCAGTCT---GAACTCCCAGCCAGCCCGGATGACTCAGATAATAGTGTGTCAGAGAGCCTGGATGAATTTGATTACTCCGTGGCTGA
E--Q--L--K--Q--Q--S-----E--L--P--A--S--P--D--D--S--D--N--S--V--S--E--S--L--D--E--F--D--Y--S--V--A--E

----------------------------------------------------------------------------------------------><----
--I--S--R--S--F--R--S--Q--Q--E--I--C--E--Q--L--N--I--N--H--M--I--Q--R--I--F--L--I--T--L--D--N--S--D-
GATTAGCCGCTCATTCCGATCACAGCAGGAAATATGTGAGCAACTCAACATCAATCACATGATCCAAAGGATCTTCCTTATTACTCTGGACAACAGTGAT
:::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::   ::.
GATTAGCCGCTCATTCCGTTCACAGCAGGAAATATGTGAGCAACTCAACATCAATCACATGATCCAAAGGATCTTCCTCATTACTCTGGACAAC---GAC
--I--S--R--S--F--R--S--Q--Q--E--I--C--E--Q--L--N--I--N--H--M--I--Q--R--I--F--L--I--T--L--D--N-----D-

----------------------------------------------------------------------------------------------------
-P--S--L--K--S--G--N--G--I--P--S--R--C--V--Y--L--E--E--M--A--V--E--L--E--D--Q--D--W--L--D--M--S--N--
CCCAGCTTGAAAAGCGGGAATGGCATCCCTAGCCGTTGTGTGTATTTGGAAGAAATGGCAGTAGAGCTAGAAGATCAAGACTGGCTTGATATGAGCAATG
:: :::.:::::::.::::::::::::::.::::::::::::::::::::::::::::::::::: ::.::::::::.::::::::::::::::.:::.:
CCAAGCCTGAAAAGTGGGAATGGCATCCCCAGCCGTTGTGTGTATTTGGAAGAAATGGCAGTAGACCTGGAAGATCAGGACTGGCTTGATATGAACAACG
-P--S--L--K--S--G--N--G--I--P--S--R--C--V--Y--L--E--E--M--A--V--D--L--E--D--Q--D--W--L--D--M--N--N--

-------><-------------------------------------------------------------------------------------------
V--E--Q--A--L--F--A--R--L--L--L--Q--D--P--G--N--H--L--I--N--M--T--S--S--T--T--L--N--L--S--A--D--R--D
TTGAGCAGGCCCTCTTCGCTCGCTTATTACTTCAAGATCCAGGCAACCACTTAATTAACATGACTTCTTCTACAACGCTAAATCTCTCTGCTGATCGAGA
: ::::::::. :::::.::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::.:.::::::::::::::::::::
TAGAGCAGGCTGTCTTCACTCGCTTATTACTTCAAGATCCAGGCAACCACTTGATTAACATGACTTCTTCTACAACGTTGAATCTCTCTGCTGATCGAGA
V--E--Q--A--V--F--T--R--L--L--L--Q--D--P--G--N--H--L--I--N--M--T--S--S--T--T--L--N--L--S--A--D--R--D

------------------------------------------------------------><--------------------------------------
--A--G--E--R--H--I--F--C--Y--L--Y--S--C--F--Q--R--A--K--E--E--I--T--K--V--P--E--N--L--L--P--F--A--V-
TGCAGGAGAGAGGCACATTTTTTGTTACCTTTACTCCTGCTTCCAGAGAGCCAAGGAAGAGATTACCAAAGTTCCAGAGAACCTGCTACCCTTTGCAGTG
::::::.::::::::::::::::::::::::::.:::::::::::.:::::::::::::::                                       
TGCAGGGGAGAGGCACATTTTTTGTTACCTTTATTCCTGCTTCCAAAGAGCCAAGGAAGAG---------------------------------------
--A--G--E--R--H--I--F--C--Y--L--Y--S--C--F--Q--R--A--K--E--E----------------------------------------

----------------------------------------------------------------------------------------------------
-Q--C--R--N--L--T--V--S--N--T--R--T--V--L--L--T--P--E--I--Y--V--D--Q--N--I--H--E--Q--L--V--D--L--M--
CAGTGCAGAAACCTCACTGTGTCCAATACCCGAACAGTTCTTCTCACCCCAGAGATCTATGTTGACCAAAACATCCATGAGCAACTGGTAGATTTGATGT
::: ::::.::.::::::: :::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::
CAGGGCAGGAATCTCACTGGGTCCAATACCCGAACGGTTCTCCTCACCCCAGAGATCTATGTTGACCAAAACATCCACGAGCAACTGGTAGATTTGATGT
-Q--G--R--N--L--T--G--S--N--T--R--T--V--L--L--T--P--E--I--Y--V--D--Q--N--I--H--E--Q--L--V--D--L--M--

-----------------------------------------><---------------------------------------------------------
L--E--A--I--Q--G--A--R--E--Y--M--N--K--I--Y--F--E--D--V--T--E--F--L--E--E--V--I--E--A--L--I--L--D--E
TAGAAGCCATCCAGGGAGCCCGTGAGTACATGAACAAGATCTATTTTGAAGATGTAACTGAGTTTCTGGAAGAGGTCATTGAAGCCTTGATATTGGATGA
:.:::::::::: .:::: ::::::::::::.:.:::::::   ::::::..::::.::::.:::::::: :::.::::.:.::::::::::.:::::::
TGGAAGCCATCCTAGGAGGCCGTGAGTACATAAGCAAGATC---TTTGAAAGTGTAGCTGAATTTCTGGATGAGATCATCGGAGCCTTGATACTGGATGA
L--E--A--I--L--G--G--R--E--Y--I--S--K--I-----F--E--S--V--A--E--F--L--D--E--I--I--G--A--L--I--L--D--E

----------------------------------------------------------------------------------------------------
--E--V--R--T--F--P--E--V--M--I--P--V--F--D--I--L--L--G--R--I--K--D--L--E--L--C--Q--I--L--L--Y--A--Y-
GGAAGTTAGAACATTTCCAGAAGTCATGATTCCAGTGTTTGATATTTTATTGGGCCGAATAAAAGATCTAGAGCTCTGTCAGATCCTTTTGTATGCATAT
::::::: ::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::.:::::::: ::::::::::::
GGAAGTTCGAACATTTTCAGAAGTCATGATTCCAGTGTTTGATATTTTATTGGGCCGAATAAAAGATCTAGACCTCTGCCAGATCCTGTTGTATGCATAT
--E--V--R--T--F--S--E--V--M--I--P--V--F--D--I--L--L--G--R--I--K--D--L--D--L--C--Q--I--L--L--Y--A--Y-

--------------------------------------------><------------------------------------------------------
-L--D--I--L--L--Y--F--T--R--Q--K--D--M--A--K--V--F--V--E--Y--I--Q--P--K--D--P--T--N--G--Q--M--Y--Q--
CTGGATATTCTTCTCTATTTCACTAGGCAAAAAGATATGGCAAAGGTTTTTGTAGAATACATTCAGCCCAAGGACCCTACCAATGGGCAAATGTACCAGA
:::::.::::::::::::::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::::: .:::::.::.::::::::::
CTGGACATTCTTCTCTATTTTACTAGGCAAAAGGATATGGCAAAGGTTTTTGTAGAATACATTCAGCCCAAGGACCCTAATAATGGACAGATGTACCAGA
-L--D--I--L--L--Y--F--T--R--Q--K--D--M--A--K--V--F--V--E--Y--I--Q--P--K--D--P--N--N--G--Q--M--Y--Q--

----------------------------------------------------------------------------------------------------
K--T--L--L--G--V--I--L--S--I--S--C--L--L--K--T--P--G--V--V--E--N--H--G--Y--F--L--N--P--S--R--S--S--P
AGACCTTGCTGGGAGTAATTCTGAGTATCTCCTGCTTATTAAAGACTCCGGGTGTTGTAGAAAATCATGGCTACTTTTTGAATCCATCTCGTTCCAGCCC
:::::::::::::::::::.::::.:::.:::::::::::::::::::::::::: :::::::::::::: :::::..:::::::::::::::::::.::
AGACCTTGCTGGGAGTAATCCTGAATATTTCCTGCTTATTAAAGACTCCGGGTGTGGTAGAAAATCATGGATACTTCCTGAATCCATCTCGTTCCAGTCC
K--T--L--L--G--V--I--L--N--I--S--C--L--L--K--T--P--G--V--V--E--N--H--G--Y--F--L--N--P--S--R--S--S--P

------------------------------------><--------------------------------------------------------------
--Q--E--I--K--V--Q--E--A--N--I--H--Q--F--M--A--Q--F--H--E--K--I--Y--Q--M--L--K--N--L--L--Q--L--S--P-
CCAGGAGATCAAAGTACAGGAGGCCAACATCCATCAGTTCATGGCTCAGTTCCACGAAAAGATCTACCAGATGCTGAAGAACTTACTCCAGCTCTCTCCA
:::::::::::::::::::::::::::.::.::::::                                                               
CCAGGAGATCAAAGTACAGGAGGCCAATATTCATCAG---------------------------------------------------------------
--Q--E--I--K--V--Q--E--A--N--I--H--Q----------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--T--K--H--C--I--L--S--W--L--G--N--C--L--H--A--N--A--G--R--T--K--I--W--A--N--Q--M--P--E--I--F--F--
GAAACCAAACACTGTATCTTGTCCTGGCTTGGAAACTGTTTGCATGCAAATGCAGGCCGCACCAAGATTTGGGCCAATCAGATGCCAGAAATCTTTTTCC
   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::
---ACCAAACACTGTATCTTGTCCTGGCTTGGAAACTGTTTGCATGCAAATGCAGGCCGCACCAAGATTTGGGCCAATCAGATGCCAGAAATCTTCTTCC
----T--K--H--C--I--L--S--W--L--G--N--C--L--H--A--N--A--G--R--T--K--I--W--A--N--Q--M--P--E--I--F--F--

----------------------------------------------------------------------------------------------------
Q--M--Y--A--S--D--A--F--F--L--N--L--G--A--A--L--L--K--L--C--Q--P--F--C--K--P--R--S--S--R--L--L--T--F
AAATGTATGCCTCAGATGCTTTCTTTCTGAATCTGGGTGCTGCTCTCCTGAAGCTATGCCAGCCATTTTGCAAACCCAGATCCTCTCGGCTCCTCACCTT
:::::::::::::.:::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::
AAATGTATGCCTCGGATGCCTTCTTTCTGAATCTGGGTGCTGCTCTCCTGAAGCTGTGCCAGCCATTTTGCAAACCCAGATCCTCTCGGCTCCTCACCTT
Q--M--Y--A--S--D--A--F--F--L--N--L--G--A--A--L--L--K--L--C--Q--P--F--C--K--P--R--S--S--R--L--L--T--F

----------------------------------------------------------------------><----------------------------
--N--P--T--Y--C--A--L--K--E--L--N--D--E--E--R--K--I--K--N--V--H--M--R--G--L--D--K--E--T--C--L--I--P-
TAATCCCACATACTGTGCCCTCAAGGAGTTGAATGATGAAGAACGAAAAATTAAAAATGTACACATGAGAGGTTTGGACAAAGAAACCTGTTTGATCCCA
::::::::: ::::::::.:: ::::::::::::::::::::::::::::: ::::::::::::::::::   :::::::::::::::::::::::::::
TAATCCCACTTACTGTGCTCTGAAGGAGTTGAATGATGAAGAACGAAAAATAAAAAATGTACACATGAGA---TTGGACAAAGAAACCTGTTTGATCCCA
--N--P--T--Y--C--A--L--K--E--L--N--D--E--E--R--K--I--K--N--V--H--M--R-----L--D--K--E--T--C--L--I--P-

-------------------------------------------------------------------------------------------><-------
-A--V--Q--E--P--K--F--P--Q--N--Y--N--L--V--T--E--N--L--A--L--T--E--Y--T--L--Y--L--G--F--H--R--L--H--
GCTGTGCAGGAGCCGAAGTTTCCACAGAACTACAACCTTGTAACAGAGAACCTTGCTCTGACAGAGTACACCTTGTACTTGGGATTTCACAGGTTGCATG
::::::::::::::.::.::::: ::::::::::::::.:: :::::::::::::..:::::::::::::::::::::::::::::::::   :::::::
GCTGTGCAGGAGCCAAAATTTCCCCAGAACTACAACCTCGTTACAGAGAACCTTGTCCTGACAGAGTACACCTTGTACTTGGGATTTCAC---TTGCATG
-A--V--Q--E--P--K--F--P--Q--N--Y--N--L--V--T--E--N--L--V--L--T--E--Y--T--L--Y--L--G--F--H-----L--H--

----------------------------------------------------------------------------------------------------
D--Q--M--V--K--I--N--Q--N--L--H--R--L--Q--V--A--W--R--D--A--Q--Q--S--S--S--P--A--A--D--N--L--R--E--Q
ATCAGATGGTAAAAATCAACCAAAATCTGCATCGGCTGCAGGTTGCCTGGCGGGATGCTCAGCAAAGTTCTAGCCCTGCTGCTGACAATCTTCGTGAGCA
:::::::::::::::::::::::::::::::::::::::::.: ::::::::::::::::::::::::::::::::::::::::::::.::.::::::::
ATCAGATGGTAAAAATCAACCAAAATCTGCATCGGCTGCAGATAGCCTGGCGGGATGCTCAGCAAAGTTCTAGCCCTGCTGCTGACAACCTCCGTGAGCA
D--Q--M--V--K--I--N--Q--N--L--H--R--L--Q--I--A--W--R--D--A--Q--Q--S--S--S--P--A--A--D--N--L--R--E--Q

----------------------------------------------------------------------------------------------------
--F--E--R--L--M--T--I--Y--L--S--T--K--T--A--M--T--E--P--Q--M--L--Q--N--C--L--N--L--Q--V--S--M--A--V-
GTTTGAACGACTGATGACCATCTATCTTTCTACCAAGACTGCCATGACAGAGCCACAAATGCTACAAAACTGCCTAAACTTGCAGGTGTCCATGGCTGTT
:::::::::::::::::::::::::::::::::::::::::::::::: ::::::::.::::::::::::::::::::.:::::::::::::::::::::
GTTTGAACGACTGATGACCATCTATCTTTCTACCAAGACTGCCATGACTGAGCCACAGATGCTACAAAACTGCCTAAATTTGCAGGTGTCCATGGCTGTT
--F--E--R--L--M--T--I--Y--L--S--T--K--T--A--M--T--E--P--Q--M--L--Q--N--C--L--N--L--Q--V--S--M--A--V-

------------------------------------------------------------------------------------------------><--
-L--L--V--Q--L--A--I--G--N--E--G--S--Q--P--I--E--L--T--F--P--L--P--D--G--Y--S--S--L--A--Y--V--P--E--
CTACTGGTTCAACTGGCCATAGGCAATGAGGGCTCACAGCCAATAGAGCTAACCTTTCCTTTGCCAGATGGCTACAGCTCTTTGGCTTATGTGCCAGAAT
:: .:.:::::.:::::::: ::::::::::::::::::::::::::::::::.::.::::::::::::::::::::.::::::::::::::::::   :
CTCTTAGTTCAGCTGGCCATCGGCAATGAGGGCTCACAGCCAATAGAGCTAACTTTCCCTTTGCCAGATGGCTACAGTTCTTTGGCTTATGTGCCA---T
-L--L--V--Q--L--A--I--G--N--E--G--S--Q--P--I--E--L--T--F--P--L--P--D--G--Y--S--S--L--A--Y--V--P-----

----------------------------------------------------------------------------------------------------
F--F--A--D--N--L--G--D--F--L--I--F--L--R--R--F--A--D--D--I--L--E--T--S--A--D--S--L--E--H--V--L--H--F
TTTTTGCAGATAACCTGGGTGATTTTCTCATTTTTCTCCGCCGCTTTGCCGATGACATTTTGGAGACATCAGCAGATTCCCTGGAGCATGTCCTTCACTT
::::::::::::::.::::::::::.::::::::::::::::::::::::::::::::.::::::::::::::::::::.::. :. :  :.: :.::::
TTTTTGCAGATAACTTGGGTGATTTCCTCATTTTTCTCCGCCGCTTTGCCGATGACATCTTGGAGACATCAGCAGATTCTCTACAAAAGCTTCATTACTT
F--F--A--D--N--L--G--D--F--L--I--F--L--R--R--F--A--D--D--I--L--E--T--S--A--D--S--L--Q--K--L--H--Y--F

-----------------------------><---------------------------------------------------------------------
--I--T--I--F--T--G--S--I--E--R--M--K--N--P--H--L--R--A--K--L--A--E--V--L--E--A--V--M--P--H--L--D--Q-
TATCACCATTTTCACTGGAAGCATAGAAAGAATGAAGAATCCCCACCTGAGGGCCAAACTAGCAGAGGTGTTGGAAGCAGTGATGCCCCACCTGGATCAG
:                              :::::::::::::::.:.:::::::::::.:::::::::::::::::::::::::::::::::::::::
T------------------------------ATGAAGAATCCCCACTTAAGGGCCAAACTGGCAGAGGTGTTGGAAGCAGTGATGCCCCACCTGGATCAG
--------------------------------M--K--N--P--H--L--R--A--K--L--A--E--V--L--E--A--V--M--P--H--L--D--Q-

----------------------------------------------------------------------------------------------------
-T--P--N--P--L--V--S--S--V--F--H--R--K--R--V--F--C--N--F--Q--Y--A--P--Q--L--A--E--A--L--I--K--V--F--
ACCCCAAATCCCTTGGTATCCAGTGTGTTCCACCGGAAACGTGTGTTCTGCAACTTTCAGTATGCACCCCAACTTGCAGAGGCTCTAATCAAGGTTTTTG
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::: :::: ::::::::.::::::::::::::.::::
ACCCCAAATCCCTTGGTATCCAGTGTGTTCCACCGGAAACGTGTGTTCTGCAACTTTGCCTATGCAGCCCACCTTGCAGAAGCTCTAATCAAGGTCTTTG
-T--P--N--P--L--V--S--S--V--F--H--R--K--R--V--F--C--N--F--A--Y--A--A--H--L--A--E--A--L--I--K--V--F--

-----------------><---------------------------------------------------------------------------------
V--D--I--E--F--T--G--D--P--H--Q--F--E--Q--K--F--N--Y--R--R--P--M--Y--P--I--L--R--Y--M--W--G--T--D--T
TGGACATCGAATTTACAGGAGACCCCCATCAATTTGAACAGAAGTTTAATTACCGCCGTCCCATGTATCCTATCCTAAGATACATGTGGGGGACAGATAC
:::::::.::.::::::   :::::::::::::::::.::::::::::::::::::::::::::::::::.::::: ::.::::::::::: ::::::: 
TGGACATTGAGTTTACA---GACCCCCATCAATTTGAGCAGAAGTTTAATTACCGCCGTCCCATGTATCCCATCCTCAGGTACATGTGGGGCACAGATAA
V--D--I--E--F--T-----D--P--H--Q--F--E--Q--K--F--N--Y--R--R--P--M--Y--P--I--L--R--Y--M--W--G--T--D--N

------------------><--------------------------------------------------------------------------------
--Y--R--E--S--I--K--D--L--A--D--Y--A--S--K--N--L--E--A--M--N--P--P--L--F--L--R--F--L--N--L--L--M--N-
CTATCGGGAGAGCATTAAGGATTTGGCTGACTATGCCTCTAAGAATTTAGAAGCCATGAATCCCCCACTTTTCCTCCGCTTTCTTAACCTGCTAATGAAT
::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CTATCGAGAGAGCATTAAGGATTTGGCTGACTATGCCTCTAAGAATTTAGAAGCCATGAATCCCCCACTTTTCCTCCGCTTTCTTAACCTGCTAATGAAT
--Y--R--E--S--I--K--D--L--A--D--Y--A--S--K--N--L--E--A--M--N--P--P--L--F--L--R--F--L--N--L--L--M--N-

--------------------------------><------------------------------------------------------------------
-D--A--I--F--L--L--D--E--A--I--Q--Y--L--S--K--I--K--I--Q--Q--I--E--K--D--R--G--E--W--D--S--L--T--P--
GATGCCATCTTCCTTTTGGATGAAGCCATACAGTATTTGAGCAAGATAAAGATTCAGCAAATTGAGAAGGATCGAGGTGAATGGGATAGTCTGACTCCAG
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.:: :::::::::::::::::::::::::
GATGCCATCTTCCTTTTGGATGAAGCCATACAGTATTTGAGCAAGATAAAGATTCAGCAGATTGAGAAGGACCGTGGTGAATGGGATAGTCTGACTCCAG
-D--A--I--F--L--L--D--E--A--I--Q--Y--L--S--K--I--K--I--Q--Q--I--E--K--D--R--G--E--W--D--S--L--T--P--

----------------------------------------------------------------------------------------------------
E--A--R--R--E--K--E--A--G--L--Q--M--F--G--Q--L--A--R--F--H--N--I--M--S--N--E--T--I--G--T--L--A--F--L
AAGCCCGCCGAGAAAAGGAGGCTGGCCTACAGATGTTTGGACAGCTGGCACGTTTCCATAACATCATGTCCAATGAAACAATCGGTACCCTTGCCTTTCT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.:::::
AAGCCCGCCGAGAAAAGGAGGCTGGCCTACAGATGTTTGGACAGCTGGCACGTTTCCATAACATCATGTCCAATGAAACAATTGGTACCCTTGCTTTTCT
E--A--R--R--E--K--E--A--G--L--Q--M--F--G--Q--L--A--R--F--H--N--I--M--S--N--E--T--I--G--T--L--A--F--L

-------><-------------------------------------------------------------------------------------------
--T--S--E--I--K--S--L--F--V--H--P--F--L--A--E--R--I--I--S--M--L--N--Y--F--L--Q--H--L--V--G--P--K--M-
CACATCAGAGATCAAGTCACTCTTTGTGCATCCCTTCCTGGCTGAGCGCATCATCTCCATGTTGAACTACTTCCTGCAACACCTGGTTGGCCCCAAGATG
 ::::::      ::.::::::::::::::.::.:::::::::::::::::::::::::::.::::::::::.::.::.::.::::::::::::::.:::
GACATCA------AAATCACTCTTTGTGCACCCTTTCCTGGCTGAGCGCATCATCTCCATGCTGAACTACTTTCTACAGCATCTGGTTGGCCCCAAAATG
--T--S--------K--S--L--F--V--H--P--F--L--A--E--R--I--I--S--M--L--N--Y--F--L--Q--H--L--V--G--P--K--M-

----------------------------------------------------------------------------------------><----------
-G--A--L--K--V--K--D--F--S--E--F--D--F--K--P--Q--Q--L--V--S--D--I--C--T--I--Y--L--N--L--G--D--E--E--
GGTGCCTTAAAAGTCAAGGACTTCAGCGAATTTGACTTCAAACCCCAGCAGCTTGTATCAGATATCTGCACTATCTACTTAAATCTTGGGGATGAGGAGA
:: :::::::::::::::::.:::::.::::::::::::::.:::::::::::.:: ::::::::::::::.::::::.:::::      ::::::::::
GGGGCCTTAAAAGTCAAGGATTTCAGTGAATTTGACTTCAAGCCCCAGCAGCTCGTTTCAGATATCTGCACCATCTACCTAAAT------GATGAGGAGA
-G--A--L--K--V--K--D--F--S--E--F--D--F--K--P--Q--Q--L--V--S--D--I--C--T--I--Y--L--N--------D--E--E--

----------------------------------------------------------------------------------------------------
N--F--C--A--T--V--P--K--D--G--R--S--Y--S--P--T--L--F--A--Q--T--V--R--V--L--K--K--I--N--K--P--G--N--M
ATTTCTGTGCCACTGTGCCCAAGGATGGACGTTCCTATTCCCCAACTCTCTTTGCACAGACAGTTCGAGTCTTGAAGAAAATAAATAAGCCTGGGAATAT
:.:::::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::.::::::.::::::::::::::::::::::.:::::
ACTTCTGTGCCACCGTGCCCAAGGATGGACGCTCCTATTCCCCAACTCTCTTTGCACAGACAGTCCGAGTCCTGAAGAAAATAAATAAGCCTGGAAATAT
N--F--C--A--T--V--P--K--D--G--R--S--Y--S--P--T--L--F--A--Q--T--V--R--V--L--K--K--I--N--K--P--G--N--M

------------------------------------><--------------------------------------------------------------
--I--M--A--F--S--N--L--A--E--R--I--K--S--L--A--D--L--Q--Q--Q--E--E--E--T--Y--A--D--A--C--D--E--F--L-
GATTATGGCTTTCAGCAACTTGGCAGAGAGAATCAAGTCTCTTGCAGACCTCCAACAACAGGAAGAGGAAACCTATGCAGATGCCTGTGATGAGTTCCTG
::::.::::::::::::::::.:::::::::::::::::::: :::::::::::.::::::::::::::.::::::::::::::::::::::::::::::
GATTGTGGCTTTCAGCAACTTAGCAGAGAGAATCAAGTCTCTGGCAGACCTCCAGCAACAGGAAGAGGAGACCTATGCAGATGCCTGTGATGAGTTCCTG
--I--V--A--F--S--N--L--A--E--R--I--K--S--L--A--D--L--Q--Q--Q--E--E--E--T--Y--A--D--A--C--D--E--F--L-

----------------------------------------------------------------------------------------------><----
-D--P--I--M--S--T--L--M--C--D--P--V--V--L--P--S--S--R--V--T--V--D--R--S--T--I--A--R--H--L--L--S--D--
GATCCCATTATGAGCACACTGATGTGTGACCCTGTGGTGCTGCCATCTTCCAGAGTCACTGTGGATAGATCCACCATTGCAAGACATTTGCTCAGTGACC
::::::::.:::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::   ::::
GATCCCATCATGAGCACACTGATGTCTGACCCTGTGGTGCTGCCATCTTCCAGAGTCACTGTGGATAGATCCACCATTGCCAGACATTTGCTC---GACC
-D--P--I--M--S--T--L--M--S--D--P--V--V--L--P--S--S--R--V--T--V--D--R--S--T--I--A--R--H--L--L-----D--

----------------------------------------------------------------------------------------------------
Q--T--D--P--F--N--R--S--P--L--T--M--D--Q--I--R--P--N--T--E--L--K--E--K--I--Q--R--W--L--A--E--R--K--Q
AAACAGATCCCTTTAACCGTAGTCCCCTCACCATGGACCAGATCCGGCCAAACACAGAACTAAAAGAAAAAATCCAACGGTGGCTTGCAGAGAGGAAACA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.::
AAACAGATCCCTTTAACCGTAGTCCCCTCACCATGGACCAGATCCGGCCAAACACAGAACTAAAAGAAAAAATCCAACGGTGGCTCGCAGAGAGGAAGCA
Q--T--D--P--F--N--R--S--P--L--T--M--D--Q--I--R--P--N--T--E--L--K--E--K--I--Q--R--W--L--A--E--R--K--Q

------------------------>
--Q-----K--E--Q--L--E--*-
ACAA---AAGGAGCAACTTGAATAG
::::   :::::::::::::::   
ACAACAAAAGGAGCAACTTGAA---
--Q--Q--K--E--Q--L--E----

Pig Consensus Sequence

>BGISUST0000879252
ATGACAGACCAGGAGAATAACAACAACATTTCAAGTAACCCCTTTGCTGCTCTTTTTGGCTCCCTGGCTGATGCCAAGCAATTTGCAGCAATCCAAAAGG
AGCAGCTGAAGCAGCAGTCT---GAACTCCCAGCCAGCCCGGATGACTCAGATAATAGTGTGTCAGAGAGCCTGGATGAATTTGATTACTCCGTGGCTGA
GATTAGCCGCTCATTCCGTTCACAGCAGGAAATATGTGAGCAACTCAACATCAATCACATGATCCAAAGGATCTTCCTCATTACTCTGGACAAC---GAC
CCAAGCCTGAAAAGTGGGAATGGCATCCCCAGCCGTTGTGTGTATTTGGAAGAAATGGCAGTAGACCTGGAAGATCAGGACTGGCTTGATATGAACAACG
TAGAGCAGGCTGTCTTCACTCGCTTATTACTTCAAGATCCAGGCAACCACTTGATTAACATGACTTCTTCTACAACGTTGAATCTCTCTGCTGATCGAGA
TGCAGGGGAGAGGCACATTTTTTGTTACCTTTATTCCTGCTTCCAAAGAGCCAAGGAAGAG---------------------------------------
CAGGGCAGGAATCTCACTGGGTCCAATACCCGAACGGTTCTCCTCACCCCAGAGATCTATGTTGACCAAAACATCCACGAGCAACTGGTAGATTTGATGT
TGGAAGCCATCCTAGGAGGCCGTGAGTACATAAGCAAGATC---TTTGAAAGTGTAGCTGAATTTCTGGATGAGATCATCGGAGCCTTGATACTGGATGA
GGAAGTTCGAACATTTTCAGAAGTCATGATTCCAGTGTTTGATATTTTATTGGGCCGAATAAAAGATCTAGACCTCTGCCAGATCCTGTTGTATGCATAT
CTGGACATTCTTCTCTATTTTACTAGGCAAAAGGATATGGCAAAGGTTTTTGTAGAATACATTCAGCCCAAGGACCCTAATAATGGACAGATGTACCAGA
AGACCTTGCTGGGAGTAATCCTGAATATTTCCTGCTTATTAAAGACTCCGGGTGTGGTAGAAAATCATGGATACTTCCTGAATCCATCTCGTTCCAGTCC
CCAGGAGATCAAAGTACAGGAGGCCAATATTCATCAG---------------------------------------------------------------
---ACCAAACACTGTATCTTGTCCTGGCTTGGAAACTGTTTGCATGCAAATGCAGGCCGCACCAAGATTTGGGCCAATCAGATGCCAGAAATCTTCTTCC
AAATGTATGCCTCGGATGCCTTCTTTCTGAATCTGGGTGCTGCTCTCCTGAAGCTGTGCCAGCCATTTTGCAAACCCAGATCCTCTCGGCTCCTCACCTT
TAATCCCACTTACTGTGCTCTGAAGGAGTTGAATGATGAAGAACGAAAAATAAAAAATGTACACATGAGA---TTGGACAAAGAAACCTGTTTGATCCCA
GCTGTGCAGGAGCCAAAATTTCCCCAGAACTACAACCTCGTTACAGAGAACCTTGTCCTGACAGAGTACACCTTGTACTTGGGATTTCAC---TTGCATG
ATCAGATGGTAAAAATCAACCAAAATCTGCATCGGCTGCAGATAGCCTGGCGGGATGCTCAGCAAAGTTCTAGCCCTGCTGCTGACAACCTCCGTGAGCA
GTTTGAACGACTGATGACCATCTATCTTTCTACCAAGACTGCCATGACTGAGCCACAGATGCTACAAAACTGCCTAAATTTGCAGGTGTCCATGGCTGTT
CTCTTAGTTCAGCTGGCCATCGGCAATGAGGGCTCACAGCCAATAGAGCTAACTTTCCCTTTGCCAGATGGCTACAGTTCTTTGGCTTATGTGCCA---T
TTTTTGCAGATAACTTGGGTGATTTCCTCATTTTTCTCCGCCGCTTTGCCGATGACATCTTGGAGACATCAGCAGATTCTCTACAAAAGCTTCATTACTT
T------------------------------ATGAAGAATCCCCACTTAAGGGCCAAACTGGCAGAGGTGTTGGAAGCAGTGATGCCCCACCTGGATCAG
ACCCCAAATCCCTTGGTATCCAGTGTGTTCCACCGGAAACGTGTGTTCTGCAACTTTGCCTATGCAGCCCACCTTGCAGAAGCTCTAATCAAGGTCTTTG
TGGACATTGAGTTTACA---GACCCCCATCAATTTGAGCAGAAGTTTAATTACCGCCGTCCCATGTATCCCATCCTCAGGTACATGTGGGGCACAGATAA
CTATCGAGAGAGCATTAAGGATTTGGCTGACTATGCCTCTAAGAATTTAGAAGCCATGAATCCCCCACTTTTCCTCCGCTTTCTTAACCTGCTAATGAAT
GATGCCATCTTCCTTTTGGATGAAGCCATACAGTATTTGAGCAAGATAAAGATTCAGCAGATTGAGAAGGACCGTGGTGAATGGGATAGTCTGACTCCAG
AAGCCCGCCGAGAAAAGGAGGCTGGCCTACAGATGTTTGGACAGCTGGCACGTTTCCATAACATCATGTCCAATGAAACAATTGGTACCCTTGCTTTTCT
GACATCA------AAATCACTCTTTGTGCACCCTTTCCTGGCTGAGCGCATCATCTCCATGCTGAACTACTTTCTACAGCATCTGGTTGGCCCCAAAATG
GGGGCCTTAAAAGTCAAGGATTTCAGTGAATTTGACTTCAAGCCCCAGCAGCTCGTTTCAGATATCTGCACCATCTACCTAAAT------GATGAGGAGA
ACTTCTGTGCCACCGTGCCCAAGGATGGACGCTCCTATTCCCCAACTCTCTTTGCACAGACAGTCCGAGTCCTGAAGAAAATAAATAAGCCTGGAAATAT
GATTGTGGCTTTCAGCAACTTAGCAGAGAGAATCAAGTCTCTGGCAGACCTCCAGCAACAGGAAGAGGAGACCTATGCAGATGCCTGTGATGAGTTCCTG
GATCCCATCATGAGCACACTGATGTCTGACCCTGTGGTGCTGCCATCTTCCAGAGTCACTGTGGATAGATCCACCATTGCCAGACATTTGCTC---GACC
AAACAGATCCCTTTAACCGTAGTCCCCTCACCATGGACCAGATCCGGCCAAACACAGAACTAAAAGAAAAAATCCAACGGTGGCTCGCAGAGAGGAAGCA
ACAACAAAAGGAGCAACTT---


>BGISUSP0000879252
MTDQENNNNISSNPFAALFGSLADAKQFAAIQKEQLKQQS-ELPASPDDSDNSVSESLDEFDYSVAEISRSFRSQQEICEQLNINHMIQRIFLITLDN-D
PSLKSGNGIPSRCVYLEEMAVDLEDQDWLDMNNVEQAVFTRLLLQDPGNHLINMTSSTTLNLSADRDAGERHIFCYLYSCFQRAKEE-------------
QGRNLTGSNTRTVLLTPEIYVDQNIHEQLVDLMLEAILGGREYISKI-FESVAEFLDEIIGALILDEEVRTFSEVMIPVFDILLGRIKDLDLCQILLYAY
LDILLYFTRQKDMAKVFVEYIQPKDPNNGQMYQKTLLGVILNISCLLKTPGVVENHGYFLNPSRSSPQEIKVQEANIHQ---------------------
-TKHCILSWLGNCLHANAGRTKIWANQMPEIFFQMYASDAFFLNLGAALLKLCQPFCKPRSSRLLTFNPTYCALKELNDEERKIKNVHMR-LDKETCLIP
AVQEPKFPQNYNLVTENLVLTEYTLYLGFH-LHDQMVKINQNLHRLQIAWRDAQQSSSPAADNLREQFERLMTIYLSTKTAMTEPQMLQNCLNLQVSMAV
LLVQLAIGNEGSQPIELTFPLPDGYSSLAYVP-FFADNLGDFLIFLRRFADDILETSADSLQKLHYF----------MKNPHLRAKLAEVLEAVMPHLDQ
TPNPLVSSVFHRKRVFCNFAYAAHLAEALIKVFVDIEFT-DPHQFEQKFNYRRPMYPILRYMWGTDNYRESIKDLADYASKNLEAMNPPLFLRFLNLLMN
DAIFLLDEAIQYLSKIKIQQIEKDRGEWDSLTPEARREKEAGLQMFGQLARFHNIMSNETIGTLAFLTS--KSLFVHPFLAERIISMLNYFLQHLVGPKM
GALKVKDFSEFDFKPQQLVSDICTIYLN--DEENFCATVPKDGRSYSPTLFAQTVRVLKKINKPGNMIVAFSNLAERIKSLADLQQQEEETYADACDEFL
DPIMSTLMSDPVVLPSSRVTVDRSTIARHLL-DQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQQKEQL-