Sequences
EST Library Info
che2Heart - RNA from China
Clusters
Oligos
SNPs

Gene ID ENSG00000006788 (click for geneview)
Transcript ID ENST00000252172(link to ensembl)
Symbol MYH13
Localtion Chromosome:17:10145530:10217047:-1 band: 17p13.1
Description Myosin heavy chain, skeletal muscle, extraocular (MyHC-eo). [Source:Uniprot/SWISSPROT;Acc:Q9UKX3]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--S--D--A--E--M--A--I--F--G--E--A--A--P--Y--L--R--K--P--E--K--E--R--I--E--A--Q--N--R--P--F--D--
ATGAGCTCTGACGCAGAAATGGCCATTTTTGGAGAAGCAGCTCCCTACCTCCGGAAACCAGAGAAGGAGAGAATCGAGGCTCAAAATCGTCCATTCGATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--K--K--A--C--F--V--A--D--N--K--E--M--Y--V--K--G--M--I--Q--T--R--E--N--D--K--V--I--V--K--T--L--D--D
CCAAGAAAGCCTGCTTTGTAGCGGATAATAAGGAAATGTATGTGAAAGGCATGATCCAGACTAGGGAAAATGACAAAGTCATAGTCAAGACCCTCGATGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---><-----------------------------------------------------------------------------------------------
--R--M--L--T--L--N--N--D--Q--V--F--P--M--N--P--P--K--F--D--K--I--E--D--M--A--M--M--T--H--L--H--E--P-
CCGGATGCTCACTCTGAACAATGACCAGGTCTTCCCCATGAACCCTCCCAAATTTGACAAGATCGAGGACATGGCCATGATGACTCACCTGCATGAACCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------><---------------------------------------------------
-A--V--L--Y--N--L--K--E--R--Y--A--A--W--M--I--Y--T--Y--S--G--L--F--C--V--T--V--N--P--Y--K--W--L--P--
GCTGTTCTGTACAACCTCAAAGAGCGCTATGCAGCCTGGATGATCTACACCTACTCAGGCCTCTTCTGTGTCACCGTCAACCCCTACAAGTGGCTGCCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--Y--K--P--E--V--V--A--A--Y--R--G--K--K--R--Q--E--A--P--P--H--I--F--S--I--S--D--N--A--Y--Q--F--M--L
TGTACAAGCCCGAGGTGGTGGCTGCCTACAGAGGCAAAAAGCGCCAGGAGGCCCCGCCCCACATCTTCTCCATCTCTGACAATGCCTATCAGTTCATGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----><--------------------------><------------------------------------------------------------------
--T--D--R--D--N--Q--S--I--L--I--T--G--E--S--G--A--G--K--T--V--N--T--K--R--V--I--Q--Y--F--A--T--I--A-
GACTGATCGAGACAACCAGTCTATCCTCATCACCGGAGAATCCGGGGCTGGGAAGACTGTGAACACCAAGCGTGTCATCCAGTATTTTGCAACAATTGCA
                                  ::.:::::::::::::::::::: ::::::::::::::::::::::::::.:::::::::::::::
----------------------------------GGGGAATCCGGGGCTGGGAAGACGGTGAACACCAAGCGTGTCATCCAGTACTTTGCAACAATTGCA
-----------------------------------G--E--S--G--A--G--K--T--V--N--T--K--R--V--I--Q--Y--F--A--T--I--A-

--------------------------------------------><------------------------------------------------------
-V--T--G--D--K--K--K--E--T--Q--P--G--K--M--Q--G--T--L--E--D--Q--I--I--Q--A--N--P--L--L--E--A--F--G--
GTTACCGGGGACAAGAAGAAGGAGACACAGCCAGGCAAAATGCAGGGAACCCTAGAGGATCAGATCATCCAGGCCAACCCACTGCTGGAGGCCTTTGGAA
::.::.::::::::::::::::::  .::::::::::::::::::                                                       
GTCACTGGGGACAAGAAGAAGGAGCAGCAGCCAGGCAAAATGCAG-------------------------------------------------------
-V--T--G--D--K--K--K--E--Q--Q--P--G--K--M--Q--------------------------------------------------------

-------------------------------------><-------------------------------------------------------------
N--A--K--T--V--R--N--D--N--S--S--R--F--G--K--F--I--R--I--H--F--G--A--T--G--K--L--A--S--A--D--I--E--T
ATGCCAAGACTGTGAGGAATGACAACTCCTCAAGATTTGGGAAGTTCATTCGGATTCATTTTGGAGCCACAGGAAAGCTGGCATCGGCAGACATCGAAAC
                                                  ::::::::.:::::::::::::::::::::::.:: ::.:::::::::  
--------------------------------------------------CGGATTCACTTTGGAGCCACAGGAAAGCTGGCGTCCGCGGACATCGAA--
---------------------------------------------------R--I--H--F--G--A--T--G--K--L--A--S--A--D--I--E---

-><-------------------------------------------------------------------------------------------------
--Y--L--L--E--K--S--R--V--T--F--Q--L--S--S--E--R--S--Y--H--I--F--Y--Q--I--M--S--N--K--K--P--E--L--I-
TTATCTGTTAGAAAAATCCAGAGTGACGTTTCAATTATCCAGTGAGAGAAGCTATCATATTTTCTACCAAATTATGTCAAACAAGAAGCCAGAACTAATT
    :: ::::::::::::::.:::::.:::::.:::::::::::::::::::::::::::::.::.:::::.:::::::::::::::::::::::    
----CTCTTAGAAAAATCCAGGGTGACATTTCAGTTATCCAGTGAGAGAAGCTATCATATTTTTTATCAAATCATGTCAAACAAGAAGCCAGAACTC---
-----L--L--E--K--S--R--V--T--F--Q--L--S--S--E--R--S--Y--H--I--F--Y--Q--I--M--S--N--K--K--P--E--L----

><--------------------------------------------------------------------------------------------------
-D--L--L--L--I--S--T--N--P--F--D--F--P--F--V--S--Q--G--E--V--T--V--A--S--I--D--D--S--E--E--L--L--A--
GACCTGCTTCTGATCTCCACCAACCCCTTCGACTTCCCCTTCGTGAGCCAAGGAGAGGTCACGGTAGCCAGTATCGATGACAGTGAAGAACTGCTGGCGA
   :::::::: ::::: :::::.:::::.:::::::::::::::::::::::::::::::: ::.:::::.::.::.::::::::.::.:::.::::::
---CTGCTTCTCATCTCAACCAATCCCTTTGACTTCCCCTTCGTGAGCCAAGGAGAGGTCACCGTGGCCAGCATTGACGACAGTGAGGAGCTGTTGGCGA
----L--L--L--I--S--T--N--P--F--D--F--P--F--V--S--Q--G--E--V--T--V--A--S--I--D--D--S--E--E--L--L--A--

----><----------------------------------------------------------------------------------------------
T--D--N--A--I--D--I--L--G--F--S--S--E--E--K--V--G--I--Y--K--L--T--G--A--V--M--H--Y--G--N--M--K--F--K
CAGATAATGCCATTGACATCCTGGGCTTCAGCTCAGAGGAGAAAGTCGGGATCTACAAACTGACGGGAGCCGTGATGCATTATGGGAACATGAAGTTCAA
: :::                                                                                               
CTGAT-----------------------------------------------------------------------------------------------
T--D------------------------------------------------------------------------------------------------

-------------------------------------------><-------------------------------------------------------
--Q--K--Q--R--E--E--Q--A--E--P--D--G--T--E--V--A--D--K--A--G--Y--L--M--G--L--N--S--A--E--M--L--K--G-
GCAGAAGCAGCGTGAGGAGCAGGCGGAGCCAGACGGCACCGAAGTGGCTGACAAAGCCGGATACCTGATGGGACTGAATTCTGCAGAAATGCTGAAGGGC
                                              :::::::::::.::.::::::::::: :::::::::::::::::::::::.:::
----------------------------------------------GCTGACAAAGCTGGGTACCTGATGGGTCTGAATTCTGCAGAAATGCTGAAAGGC
-----------------------------------------------A--D--K--A--G--Y--L--M--G--L--N--S--A--E--M--L--K--G-

--------------------------------------------------------------><------------------------------------
-L--C--C--P--R--V--K--V--G--N--E--Y--V--T--K--G--Q--N--V--Q--Q--V--T--N--S--V--G--A--L--A--K--A--V--
CTGTGCTGTCCAAGGGTGAAGGTTGGCAATGAATATGTCACTAAAGGGCAAAATGTCCAGCAGGTGACCAATTCGGTGGGTGCTCTGGCCAAAGCCGTCT
:::::::::::::::::::::::.:: ::.::::::::::::::.::.:::::::::::::::                                     
CTGTGCTGTCCAAGGGTGAAGGTCGGGAACGAATATGTCACTAAGGGACAAAATGTCCAGCAG-------------------------------------
-L--C--C--P--R--V--K--V--G--N--E--Y--V--T--K--G--Q--N--V--Q--Q--------------------------------------

----------------------------------------------------------------------------------------------------
Y--E--K--M--F--L--W--M--V--T--R--I--N--Q--Q--L--D--T--K--Q--P--R--Q--Y--F--I--G--V--L--D--I--A--G--F
ACGAGAAGATGTTCCTGTGGATGGTCACCCGCATCAACCAGCAGCTGGACACCAAGCAGCCCAGGCAGTACTTCATCGGGGTCTTGGACATTGCTGGCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><--------------------------------------------------------------------------------------
--E--I--F--D--F--N--S--L--E--Q--L--C--I--N--F--T--N--E--K--L--Q--Q--F--F--N--H--H--M--F--V--L--E--Q-
TGAGATCTTTGATTTCAACAGCCTGGAGCAGCTGTGCATCAACTTCACCAATGAGAAACTGCAACAGTTTTTCAACCACCACATGTTCGTGCTGGAGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------><---------------
-E--E--Y--K--K--E--G--I--E--W--E--F--I--D--F--G--M--D--L--A--A--C--I--E--L--I--E--K--P--M--G--I--F--
GAAGAGTACAAGAAGGAAGGCATCGAGTGGGAGTTCATTGACTTCGGAATGGACCTGGCTGCCTGCATCGAGCTCATCGAGAAGCCTATGGGCATCTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--I--L--E--E--E--C--M--F--P--K--A--T--D--T--S--F--K--N--K--L--Y--D--Q--H--L--G--K--S--N--N--F--Q--K
CCATCCTGGAAGAGGAGTGCATGTTCCCCAAGGCAACAGACACCTCCTTCAAGAACAAGCTGTATGACCAGCATCTTGGAAAATCCAACAACTTCCAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--K--P--A--K--G--K--A--E--A--H--F--S--L--V--H--Y--A--G--T--V--D--Y--N--I--A--G--W--L--D--K--N--K-
GCCCAAGCCTGCCAAAGGCAAGGCTGAGGCTCACTTCTCGCTGGTGCACTATGCCGGCACCGTGGACTACAACATCGCCGGCTGGCTGGACAAAAACAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------------><-----
-D--P--L--N--E--T--V--V--G--L--Y--Q--K--S--S--L--K--L--L--S--F--L--F--S--N--Y--A--G--A--E--T--G--D--
GACCCCCTGAACGAGACTGTGGTGGGGCTGTACCAGAAGTCTTCGCTGAAGCTTCTCTCCTTCCTTTTTTCCAACTATGCTGGTGCAGAGACAGGCGACT
                                                                                                ::::
------------------------------------------------------------------------------------------------GACT
-------------------------------------------------------------------------------------------------D--

-------------------------------------------------------------------><-------------------------------
S--G--G--S--K--K--G--G--K--K--K--G--S--S--F--Q--T--V--S--A--V--F--R--E--N--L--N--K--L--M--T--N--L--R
CCGGAGGAAGCAAGAAGGGCGGGAAGAAGAAGGGCTCCTCTTTCCAGACCGTGTCGGCCGTGTTCAGGGAAAATTTAAACAAATTGATGACTAACTTAAG
::::.::::::::::::::::::::::::::::: :::::.:::::::::::::: ::.:::::::::::::::.::::::::.:::::::.::.:::::
CCGGGGGAAGCAAGAAGGGCGGGAAGAAGAAGGGATCCTCCTTCCAGACCGTGTCTGCTGTGTTCAGGGAAAATCTAAACAAACTGATGACCAATTTAAG
S--G--G--S--K--K--G--G--K--K--K--G--S--S--F--Q--T--V--S--A--V--F--R--E--N--L--N--K--L--M--T--N--L--R

-------------------------------------------------------><-------------------------------------------
--S--T--H--P--H--F--V--R--C--L--I--P--N--E--T--K--T--P--G--V--M--D--H--Y--L--V--M--H--Q--L--R--C--N-
GAGCACCCACCCTCACTTTGTACGATGTCTGATTCCCAATGAGACCAAGACTCCTGGTGTGATGGACCACTACTTGGTCATGCACCAGCTGCGCTGTAAC
::::::.::::::::::::::::::::::::::::::::.::::::::::::      :: ::: :::::.::.::::::::::::::::::::::::::
GAGCACTCACCCTCACTTTGTACGATGTCTGATTCCCAACGAGACCAAGACT------GTCATGNACCACCACCTGGTCATGCACCAGCTGCGCTGTAAC
--S--T--H--P--H--F--V--R--C--L--I--P--N--E--T--K--T--------V--M--X--H--H--L--V--M--H--Q--L--R--C--N-

-------------------------------------------------------------------------><-------------------------
-G--V--L--E--G--I--R--I--C--R--K--G--F--P--S--R--I--L--Y--A--D--F--K--Q--R--Y--R--I--L--N--A--S--A--
GGGGTCCTCGAGGGCATCCGGATTTGCAGGAAGGGATTCCCCAGCCGGATCCTCTATGCTGACTTCAAGCAGCGGTACCGGATCCTCAATGCCAGTGCTA
:::::::: :::::::::::::::::::::::.::.::::::::::::::::::::::::::::::::::::   :::::.::::::::.:::::.::.:
GGGGTCCTGGAGGGCATCCGGATTTGCAGGAAAGGGTTCCCCAGCCGGATCCTCTATGCTGACTTCAAGCAG---TACCGAATCCTCAACGCCAGCGCCA
-G--V--L--E--G--I--R--I--C--R--K--G--F--P--S--R--I--L--Y--A--D--F--K--Q-----Y--R--I--L--N--A--S--A--

-------------------------------------------------------------------------------------------------><-
I--P--E--G--Q--F--I--D--S--K--N--A--S--E--K--L--L--N--S--I--D--V--D--R--E--Q--F--R--F--G--N--T--K--V
TCCCTGAAGGGCAGTTCATTGACAGCAAAAATGCCTCAGAGAAGCTCCTCAACTCCATCGATGTGGACCGGGAGCAGTTCAGGTTCGGCAACACCAAGGT
:::: ::.:::::::::::.:::::::::::.::.:: ::::::::.::::::::::::::.:::::::::::::::: :::::::::: ::::::::::
TCCCAGAGGGGCAGTTCATCGACAGCAAAAACGCTTCCGAGAAGCTTCTCAACTCCATCGACGTGGACCGGGAGCAGTACAGGTTCGGCCACACCAAGGT
I--P--E--G--Q--F--I--D--S--K--N--A--S--E--K--L--L--N--S--I--D--V--D--R--E--Q--Y--R--F--G--H--T--K--V

----------------------------------------------------------------------------------------------------
--F--F--K--A--G--L--L--G--L--L--E--E--M--R--D--E--K--L--V--T--L--M--T--S--T--Q--A--V--C--R--G--Y--L-
GTTTTTCAAAGCTGGGCTCCTGGGACTTTTGGAGGAGATGAGAGATGAGAAGCTGGTGACGCTGATGACAAGCACGCAGGCGGTGTGCAGGGGGTACCTG
:::::::::::::::::::::::::::.::::::::::::::.::.:::::::::::::: ::::::::: :::::::::: :::::: :::::::::::
GTTTTTCAAAGCTGGGCTCCTGGGACTCTTGGAGGAGATGAGGGACGAGAAGCTGGTGACCCTGATGACACGCACGCAGGCCGTGTGCCGGGGGTACCTG
--F--F--K--A--G--L--L--G--L--L--E--E--M--R--D--E--K--L--V--T--L--M--T--R--T--Q--A--V--C--R--G--Y--L-

----------------------------------><----------------------------------------------------------------
-M--R--V--E--F--K--K--M--M--E--R--R--D--S--I--F--C--I--Q--Y--N--I--R--S--F--M--N--V--K--H--W--P--W--
ATGCGGGTGGAGTTCAAGAAGATGATGGAGAGGAGGGACTCCATCTTCTGCATCCAGTACAACATCCGCTCTTTTATGAACGTCAAGCACTGGCCCTGGA
::::::.::::::::::::::::: ::::: ::   ::::::::::::::::::::::::::::::::  :.::.:::::::::::::::::::::::::
ATGCGGATGGAGTTCAAGAAGATGCTGGAGCGG---GACTCCATCTTCTGCATCCAGTACAACATCCGAGCCTTCATGAACGTCAAGCACTGGCCCTGGA
-M--R--M--E--F--K--K--M--L--E--R-----D--S--I--F--C--I--Q--Y--N--I--R--A--F--M--N--V--K--H--W--P--W--

----------------------------------------------------------------------------------------------------
M--N--L--F--F--K--I--K--P--L--L--K--S--A--E--A--E--K--E--M--A--T--M--K--E--D--F--E--R--T--K--E--E--L
TGAACCTGTTCTTCAAAATCAAGCCCCTGCTGAAGAGTGCAGAGGCCGAGAAGGAGATGGCCACCATGAAGGAAGACTTTGAGAGGACCAAGGAAGAACT
:::::::::::::::::::.::::::::::: :::::.::.::::: :::::.::::::::::::::::::::.:::::.:::::.::::::::::::::
TGAACCTGTTCTTCAAAATTAAGCCCCTGCTCAAGAGCGCGGAGGCGGAGAAAGAGATGGCCACCATGAAGGAGGACTTCGAGAGAACCAAGGAAGAACT
M--N--L--F--F--K--I--K--P--L--L--K--S--A--E--A--E--K--E--M--A--T--M--K--E--D--F--E--R--T--K--E--E--L

------------------------------------------------------------------------------------------><--------
--A--R--S--E--A--R--R--K--E--L--E--E--K--M--V--S--L--L--Q--E--K--N--D--L--Q--L--Q--V--Q--S--E--T--E-
GGCCCGATCTGAGGCTCGCCGGAAGGAGCTGGAGGAGAAAATGGTCTCCCTCCTGCAGGAGAAGAATGACCTCCAATTGCAGGTCCAGTCTGAAACAGAA
:::: ::::.:::::::::::::::::::::::::::::::::::  :::: :: :::::.::::::::::::::.::::::::::::::::::::::::
GGCCAGATCCGAGGCTCGCCGGAAGGAGCTGGAGGAGAAAATGGTAACCCTGCTCCAGGAAAAGAATGACCTCCAGTTGCAGGTCCAGTCTGAAACAGAA
--A--R--S--E--A--R--R--K--E--L--E--E--K--M--V--T--L--L--Q--E--K--N--D--L--Q--L--Q--V--Q--S--E--T--E-

----------------------------------------------------------------------------------------------------
-N--L--M--D--A--E--E--R--C--E--G--L--I--K--S--K--I--L--L--E--A--K--V--K--E--L--T--E--R--L--E--E--E--
AATCTGATGGACGCTGAGGAACGGTGTGAAGGACTCATCAAAAGCAAGATCCTACTGGAAGCAAAAGTCAAGGAGCTGACGGAGAGATTGGAAGAGGAAG
::::::::::::::.:::::.::.:::::.::.:::::::::::::::::.: ::::::.:: ::::: ::::::::::  :::::..::::::::::.:
AATCTGATGGACGCCGAGGAGCGATGTGAGGGGCTCATCAAAAGCAAGATTCAACTGGAGGCCAAAGTGAAGGAGCTGAACGAGAGGCTGGAAGAGGAGG
-N--L--M--D--A--E--E--R--C--E--G--L--I--K--S--K--I--Q--L--E--A--K--V--K--E--L--N--E--R--L--E--E--E--

----------------------------------------------------------------------------------------------------
E--E--M--N--S--E--L--V--A--K--K--R--N--L--E--D--K--C--S--S--L--K--R--D--I--D--D--L--E--L--T--L--T--K
AGGAGATGAATTCTGAATTGGTTGCCAAGAAGAGGAATCTGGAAGATAAATGCTCCTCTCTCAAGAGAGACATTGATGACCTGGAGCTGACCTTGACGAA
:::::.::::.::.::..:::::::::::::.:::::.:::::::::::.::::::::.:::::.::.:::::.::.:::::::::::::: .::.: ::
AGGAGGTGAACTCCGAGCTGGTTGCCAAGAAAAGGAACCTGGAAGATAAGTGCTCCTCCCTCAAAAGGGACATCGACGACCTGGAGCTGACGCTGGCCAA
E--E--V--N--S--E--L--V--A--K--K--R--N--L--E--D--K--C--S--S--L--K--R--D--I--D--D--L--E--L--T--L--A--K

---------------------------------><-----------------------------------------------------------------
--V--E--K--E--K--H--A--T--E--N--K--V--K--N--L--S--E--E--M--T--A--L--E--E--N--I--S--K--L--T--K--E--K-
AGTTGAAAAGGAGAAGCATGCCACAGAGAACAAGGTAAAGAATCTTTCCGAAGAAATGACAGCACTTGAAGAAAACATTTCCAAATTGACCAAAGAAAAG
.:: ::.:::::::::::.:::::.:::::::::::::::::::::::.::::::::::::::.:: ::::.:::: :::::::::::::::::::.:::
GGTGGAGAAGGAGAAGCACGCCACGGAGAACAAGGTAAAGAATCTTTCTGAAGAAATGACAGCGCTGGAAGGAAACCTTTCCAAATTGACCAAAGAGAAG
--V--E--K--E--K--H--A--T--E--N--K--V--K--N--L--S--E--E--M--T--A--L--E--G--N--L--S--K--L--T--K--E--K-

----------------------------------------------------------------------------------------------------
-K--S--L--Q--E--A--H--Q--Q--T--L--D--D--L--Q--V--E--E--D--K--V--N--G--L--I--K--I--N--A--K--L--E--Q--
AAATCTCTACAGGAGGCCCATCAGCAAACACTGGATGATCTTCAGGTGGAAGAAGATAAAGTCAATGGTCTAATCAAAATAAATGCCAAGCTTGAACAGC
::::::::.:::::.:::::::::::::::::::::::.:::::::::::::::                                              
AAATCTCTGCAGGAAGCCCATCAGCAAACACTGGATGACCTTCAGGTGGAAGAA----------------------------------------------
-K--S--L--Q--E--A--H--Q--Q--T--L--D--D--L--Q--V--E--E-----------------------------------------------

----------><----------------------------------------------------------------------------------------
Q--T--D--D--L--E--G--S--L--E--Q--E--K--K--L--R--A--D--L--E--R--A--K--R--K--L--E--G--D--L--K--M--S--Q
AAACAGATGATCTTGAGGGTTCCTTAGAGCAGGAGAAGAAACTGCGGGCGGACTTGGAAAGGGCGAAGAGGAAGCTGGAAGGAGATCTGAAAATGTCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------><------------------------------------------
--E--S--I--M--D--L--E--N--D--K--Q--Q--I--E--E--K--L--K--K--K--E--F--E--L--S--Q--L--Q--A--K--I--D--D-
GGAATCCATTATGGATCTAGAAAATGACAAGCAGCAAATAGAAGAGAAATTGAAAAAGAAGGAGTTTGAACTCAGTCAGTTACAAGCCAAAATAGATGAC
                                                          :::::::::::: ::::::::::.::..::::.:: ::.:::
----------------------------------------------------------AAGGAGTTTGAAATCAGTCAGTTGCAGACCAAGATTGACGAC
-----------------------------------------------------------K--E--F--E--I--S--Q--L--Q--T--K--I--D--D-

-----------------------------------------------><---------------------------------------------------
-E--Q--V--H--S--L--Q--F--Q--K--K--I--K--E--L--Q--A--R--I--E--E--L--E--E--E--I--E--A--E--H--T--L--R--
GAACAAGTCCACAGTTTGCAGTTTCAAAAGAAGATTAAAGAACTGCAAGCCCGCATAGAAGAGCTGGAGGAGGAAATTGAAGCGGAACACACGCTCAGAG
::::::::.::::::.:::::.: ::.::::::::::::::::::                                                       
GAACAAGTTCACAGTCTGCAGCTGCAGAAGAAGATTAAAGAACTG-------------------------------------------------------
-E--Q--V--H--S--L--Q--L--Q--K--K--I--K--E--L--------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--K--I--E--K--Q--R--S--D--L--A--R--E--L--E--E--I--S--E--R--L--E--E--A--S--G--A--T--S--A--Q--I--E--M
CCAAGATTGAGAAGCAGCGCTCAGATCTGGCCAGGGAACTGGAGGAGATCAGCGAGAGGCTGGAAGAAGCCAGTGGGGCCACTTCAGCCCAGATTGAGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--K--K--R--E--A--E--F--Q--K--M--R--R--D--L--E--E--A--T--L--Q--H--E--A--T--A--A--T--L--R--K--K--Q-
GAACAAGAAGAGGGAGGCTGAGTTCCAGAAAATGCGCAGGGACCTGGAGGAGGCCACCCTGCAGCACGAAGCCACAGCAGCCACCCTGAGGAAGAAGCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--D--S--V--A--E--L--G--E--Q--I--D--N--L--Q--R--V--K--Q--K--L--E--K--E--K--S--E--L--K--M--E--I--D--
GCAGATAGTGTGGCCGAGCTTGGGGAGCAGATTGACAACCTGCAGCGGGTGAAGCAGAAGCTGGAGAAGGAGAAGAGCGAGCTGAAGATGGAGATTGACG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------><-------------------------------------------------------------
D--M--A--S--N--I--E--A--L--S--K--S--K--S--N--I--E-----R--T--C--R-----T--V--E--D--Q--F--S--E--I--K--A
ACATGGCCAGCAACATCGAGGCTCTCTCCAAGTCAAAGAGTAACATAGAA---AGAACGTGCCGG---ACGGTAGAAGATCAATTTAGTGAAATCAAAGC
                                      ::::::.:.:::   :::..:::::::   :: ::.:::::.:::::.:.::::::::::::
--------------------------------------AGTAACGTGGAAG--AGAGTGTGCCGGG--ACTGTGGAAGACCAATTCAATGAAATCAAAGC
---------------------------------------S--N--V--E--\--R--V--C--R--\--T--V--E--D--Q--F--N--E--I--K--A

----------------------------------------------------------------------><----------------------------
--K--D--E--Q--Q--T--Q--L--I--H--D--L--N--M--Q--K--A--R--L--Q--T--Q--N--G--E--L--S--H--R--V--E--E--K-
CAAGGACGAGCAACAGACACAGTTGATCCATGATCTGAACATGCAGAAAGCAAGACTGCAGACCCAAAATGGGGAGCTGAGCCACCGAGTGGAAGAGAAG
::::::.::.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::   :::.:::::::::.:::::::::::::
CAAGGATGAACAACAGACACAGTTGATCCATGACCTGAACATGCAGAAAGCAAGACTGCAGACCCAAAAT---GAGTTGAGCCACCAAGTGGAAGAGAAG
--K--D--E--Q--Q--T--Q--L--I--H--D--L--N--M--Q--K--A--R--L--Q--T--Q--N-----E--L--S--H--Q--V--E--E--K-

-----------------------------------------------------------------------------------------><---------
-E--S--L--I--S--Q--L--T--K--S--K--Q--A--L--T--Q--Q--L--E--E--L--K--R--Q--M--E--E--E--T--K--A--K--N--
GAGTCTCTGATTTCACAGCTGACCAAAAGCAAGCAGGCCCTCACCCAGCAGCTGGAGGAGCTTAAGAGGCAAATGGAAGAAGAAACCAAGGCCAAGAACG
::: . :::::.::::::::.:::::.:.::::::.::.::::::::::::::::::::::::::::::::. :::::::::::::::::          
GAGGTGCTGATCTCACAGCTAACCAAGAACAAGCAAGCTCTCACCCAGCAGCTGGAGGAGCTTAAGAGGCAGCTGGAAGAAGAAACCAAG----------
-E--V--L--I--S--Q--L--T--K--N--K--Q--A--L--T--Q--Q--L--E--E--L--K--R--Q--L--E--E--E--T--K-----------

----------------------------------------------------------------------------------------------------
A--M--A--H--A--L--Q--S--S--R--H--D--C--D--L--L--R--E--Q--Y--E--E--E--Q--E--A--K--A--E--L--Q--R--A--L
CCATGGCGCACGCCCTGCAGTCCTCCCGCCACGACTGTGACCTGCTGCGGGAACAGTATGAGGAGGAGCAGGAAGCCAAGGCCGAGCTGCAGAGGGCGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------><------------
--S--K--A--N--S--E--V--A--Q--W--R--T--K--Y--E--T--D--A--I--Q--R--T--E--E--L--E--E--A--K--K--K--L--A-
GTCCAAGGCCAACAGTGAGGTTGCCCAGTGGAGGACCAAATACGAGACGGACGCCATTCAGCGCACAGAGGAGCTGGAGGAGGCCAAGAAAAAACTGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Q--R--L--Q--E--A--E--E--N--T--E--T--A--N--S--K--C--A--S--L--E--K--T--K--Q--R--L--Q--G--E--V--E--D--
CAGAGGCTCCAGGAAGCAGAGGAGAACACGGAGACGGCGAACTCCAAGTGCGCATCGTTGGAGAAAACCAAGCAGAGGCTGCAGGGAGAGGTGGAGGATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------><----------------------------
L--M--R--D--L--E--R--S--H--T--A--C--A--T--L--D--K--K--Q--R--N--F--D--K--V--L--A--E--W--K--Q--K--L--D
TGATGCGGGATCTGGAGCGCTCCCACACCGCCTGTGCCACACTGGACAAGAAGCAGAGGAACTTCGACAAGGTCCTTGCAGAGTGGAAGCAAAAGCTGGA
                                                                                      ::.:::::::: ::
--------------------------------------------------------------------------------------AAACAAAAGCTTGA
---------------------------------------------------------------------------------------K--Q--K--L--D

----------------------------------------------------------------------------------------------------
--E--S--Q--A--E--L--E--A--A--Q--K--E--S--R--S--L--S--T--E--L--F--K--M--R--N--A--Y--E--E--V--V--D--Q-
CGAAAGCCAGGCTGAGTTGGAAGCTGCTCAGAAGGAGTCCAGGTCACTCAGCACTGAACTCTTCAAGATGAGGAATGCCTATGAGGAGGTGGTGGACCAG
:::.::.::.::.::::::::::: ::::::::.::::::::::: :::::.::.::: ::::::::::: : ::::::::.:::::: :::::::.:::
CGAGAGTCAAGCCGAGTTGGAAGCGGCTCAGAAAGAGTCCAGGTCCCTCAGTACCGAAATCTTCAAGATGCGTAATGCCTACGAGGAGNTGGTGGATCAG
--E--S--Q--A--E--L--E--A--A--Q--K--E--S--R--S--L--S--T--E--I--F--K--M--R--N--A--Y--E--E--X--V--D--Q-

------------------------------------><--------------------------------------------------------------
-L--E--T--L--R--R--E--N--K--N--L--Q--E--E--I--S--D--L--T--E--Q--I--A--E--T--G--K--N--L--Q--E--A--E--
TTAGAGACACTGAGGCGAGAGAACAAAAATCTGCAAGAAGAGATTTCCGACTTAACTGAGCAGATTGCAGAAACTGGCAAGAATCTTCAGGAAGCGGAAA
::::::::::: ::.::.::::::::::::::::::                                                                
TTAGAGACACTCAGACGGGAGAACAAAAATCTGCAA----------------------------------------------------------------
-L--E--T--L--R--R--E--N--K--N--L--Q-----------------------------------------------------------------

-------------------------------------------------------------><-------------------------------------
K--T--K--K--L--V--E--Q--E--K--S--D--L--Q--V--A--L--E--E--V--E--G--S--L--E--H--E--E--S--K--I--L--R--V
AGACCAAGAAGCTAGTGGAGCAGGAAAAGTCAGATCTGCAGGTCGCCTTAGAAGAAGTGGAGGGTTCCTTGGAACACGAGGAGAGCAAGATCTTGCGCGT
                                                                                            .:      
--------------------------------------------------------------------------------------------CTTGCGTG
---------------------------------------------------------------------------------------------L--A--C

----------------------------------------------------------------------------------------------------
--Q--L--E--L--S--Q--V--K--S--E--L--D--R--K--V--I--E--K--D--E--E--I--E--Q--L--K--R--N--S--Q--R--A--A-
GCAGCTAGAGCTGAGCCAGGTGAAATCCGAGCTAGACCGCAAGGTCATTGAGAAGGATGAAGAAATCGAGCAGCTAAAAAGAAACAGCCAGCGGGCAGCA
 :::::::::::::.::::::.::.::::::::.:::::::::.::...:::::::::::::::::.::::::::.::.:.:::::::::::::::::::
TCAGCTAGAGCTGAACCAGGTAAAGTCCGAGCTGGACCGCAAGATCGCCGAGAAGGATGAAGAAATTGAGCAGCTGAAGAAAAACAGCCAGCGGGCAGCA
--Q--L--E--L--N--Q--V--K--S--E--L--D--R--K--I--A--E--K--D--E--E--I--E--Q--L--K--K--N--S--Q--R--A--A-

----------------------------------------------------------------------------------------------------
-E--A--L--Q--S--V--L--D--A--E--I--R--S--R--N--D--A--L--R--L--K--K--K--M--E--G--D--L--N--E--M--E--I--
GAGGCCCTGCAGAGCGTGCTGGATGCTGAAATCCGCAGCCGGAACGACGCCCTGAGGCTAAAGAAGAAGATGGAGGGAGACCTTAATGAGATGGAGATTC
:::::: ..::::::::::::::::::::.::::: ::::::::.::.::.::::::::.:::::::::::::::::::::::.::::::::::::::::
GAGGCCACACAGAGCGTGCTGGATGCTGAGATCCGGAGCCGGAATGATGCTCTGAGGCTGAAGAAGAAGATGGAGGGAGACCTCAATGAGATGGAGATTC
-E--A--T--Q--S--V--L--D--A--E--I--R--S--R--N--D--A--L--R--L--K--K--K--M--E--G--D--L--N--E--M--E--I--

----------------------------------------------------------------------><----------------------------
Q--L--G--H--S--N--R--Q--M--A--E--T--Q--K--H--L--R--T--V--Q--G--Q--L--K--D--S--Q--L--H--L--D--D--A--L
AGCTGGGCCACTCCAACCGCCAGATGGCAGAGACCCAGAAGCATCTGCGCACGGTCCAGGGCCAGCTCAAGGACTCCCAGCTGCATCTCGATGACGCCCT
:::::::::::::::::::::::.::::::::::::::::.::.::::::.:.:: :::::::::::::::::::::::::::::.:: :::::.:::: 
AGCTGGGCCACTCCAACCGCCAGGTGGCAGAGACCCAGAAACACCTGCGCGCAGTGCAGGGCCAGCTCAAGGACTCCCAGCTGCACCTGGATGATGCCCA
Q--L--G--H--S--N--R--Q--V--A--E--T--Q--K--H--L--R--A--V--Q--G--Q--L--K--D--S--Q--L--H--L--D--D--A--Q

----------------------------------------------------------------------------------------------------
--R--S--N--E--D--L--K--E--Q--L--A--I--V--E--R--R--N--G--L--L--L--E--E--L--E--E--M--K--V--A--L--E--Q-
GAGGAGCAATGAGGACCTCAAGGAGCAGCTGGCCATCGTGGAGCGCAGGAATGGCCTCCTGCTGGAGGAGCTGGAGGAAATGAAGGTGGCCCTGGAACAG
::::::::::::::.:::::::::::::::::::::::::::.::::::::.::::::.:::::::::::::::::::.:::::::::::::::::.:::
GAGGAGCAATGAGGGCCTCAAGGAGCAGCTGGCCATCGTGGAACGCAGGAACGGCCTCTTGCTGGAGGAGCTGGAGGAGATGAAGGTGGCCCTGGAGCAG
--R--S--N--E--G--L--K--E--Q--L--A--I--V--E--R--R--N--G--L--L--L--E--E--L--E--E--M--K--V--A--L--E--Q-

--------------------------------------------------------------------------><------------------------
-T--E--R--T--R--R--L--S--E--Q--E--L--L--D--A--S--D--R--V--Q--L--L--H--S--Q--N--T--S--L--I--N--T--K--
ACGGAGCGGACCCGCAGGCTGTCAGAGCAGGAGCTGCTGGACGCCAGCGACCGCGTGCAGCTCCTGCACTCCCAGAACACAAGCCTGATAAATACCAAGA
::.:::::::::::::.::::::.:::::::::::::::::::::::.:::::::::::::::::.:::::::::                         
ACAGAGCGGACCCGCAAGCTGTCGGAGCAGGAGCTGCTGGACGCCAGTGACCGCGTGCAGCTCCTACACTCCCAG-------------------------
-T--E--R--T--R--K--L--S--E--Q--E--L--L--D--A--S--D--R--V--Q--L--L--H--S--Q--------------------------

----------------------------------------------------------------------------------------------------
K--K--L--E--A--D--I--A--Q--C--Q--A--E--V--E--N--S--I--Q--E--S--R--N--A--E--E--K--A--K--K--A--I--T--D
AAAAACTGGAGGCTGACATAGCTCAGTGCCAGGCAGAGGTGGAGAACTCGATCCAGGAGTCCAGGAACGCAGAGGAGAAGGCCAAGAAGGCCATCACGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

><--------------------------------------------------------------------------------------------------
--A--A--M--M--A--E--E--L--K--K--E--Q--D--T--S--A--H--L--E--R--M--K--K--N--L--E--Q--T--V--K-----D--L-
TGCTGCCATGATGGCTGAGGAGCTAAAGAAGGAACAGGACACCAGCGCCCACCTGGAGCGGATGAAGAAGAACCTGGAGCAGACGGTGAAG---GACCTG
    ::::::::::: ::::::::.::::::::.:::::::::::::: ::::::::::: ::::.::::::: :::::::::: .: :::   ::::::
----GCCATGATGGCGGAGGAGCTGAAGAAGGAGCAGGACACCAGCGCGCACCTGGAGCGCATGAGGAAGAACATGGAGCAGACCATCAAGG--GACCTG
-----A--M--M--A--E--E--L--K--K--E--Q--D--T--S--A--H--L--E--R--M--R--K--N--M--E--Q--T--I--K--\--D--L-

--------------------------------------------------------------------------><------------------------
-Q--H--R--L--D--E--A--E--Q--L--A--L--K--G--G--K--K--Q--I--Q--K--L--E--N--R--V--R--E--L--E--N--E--L--
CAGCACCGTCTAGATGAGGCTGAACAACTGGCGCTGAAGGGCGGGAAGAAGCAGATCCAGAAACTGGAGAACCGGGTGCGGGAGCTGGAAAATGAGCTTG
:::::::: ::.::.:::::.::.::. : :: :: :::::::: ::::::::: : :::::.::::::. ::::                         
CAGCACCGGCTGGACGAGGCCGAGCAGATCGCCCTCAAGGGCGGCAAGAAGCAGCTGCAGAAGCTGGAGGCCCGG-------------------------
-Q--H--R--L--D--E--A--E--Q--I--A--L--K--G--G--K--K--Q--L--Q--K--L--E--A--R--------------------------

-------------------------------------------------------------------------------><-------------------
D--V--E--Q--K--R--G--A--E--A--L--K--G--A--H--K--Y--E--R--K--V--K--E--M--T--Y--Q--A--E--E--D--H--K--N
ATGTGGAACAGAAGAGGGGAGCTGAAGCCCTGAAGGGAGCCCACAAGTACGAACGCAAAGTCAAGGAGATGACTTACCAGGCTGAGGAGGACCACAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------><-----------------------
--I--L--R--L--Q--D--L--V--D--K--L--Q--A--K--V--K--S--Y--K--R--Q--A--E--E--A--E--E--Q--A--N--T--Q--L-
TATCCTTAGGCTCCAGGACCTGGTGGACAAGCTGCAGGCCAAAGTGAAGTCTTACAAGAGGCAGGCTGAGGAGGCGGAGGAGCAGGCCAACACGCAGCTG
                                                                            :::::.:::::::::::  : :::
----------------------------------------------------------------------------GAGGAACAGGCCAACACCAACCTG
-----------------------------------------------------------------------------E--E--Q--A--N--T--N--L-

----------------------------------------------------------------------------------------------------
-S--R--C--R--R--V--Q--H--E--L--E--E--A--A--E--R--A--D--I--A--E--S--Q--V--N--K--L--R--A--K--S--R--D--
TCCAGATGCCGGAGAGTCCAGCATGAGCTAGAGGAGGCCGCGGAGAGGGCGGACATCGCTGAGTCCCAGGTCAACAAGCTGAGGGCCAAGAGCCGAGACG
::::..: ::: :..:: :::::.:::::.:: ::::: : :::: ::::::::::::::::::::::::::::::::::  :::::             
TCCAAGTTCCGCAAGGTGCAGCACGAGCTGGATGAGGCGGAGGAGCGGGCGGACATCGCTGAGTCCCAGGTCAACAAGCTTCGGGCC-------------
-S--K--F--R--K--V--Q--H--E--L--D--E--A--E--E--R--A--D--I--A--E--S--Q--V--N--K--L--R--A--------------

----------><---------->
V--G--S--Q--R--M--P--E-
TGGGCAGCCAGCGAATGCCTGAG
                       
-----------------------
-----------------------

Pig Consensus Sequence

>BGISUST0000878143
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------GGGGAATCCGGGGCTGGGAAGACGGTGAACACCAAGCGTGTCATCCAGTACTTTGCAACAATTGCA
GTCACTGGGGACAAGAAGAAGGAGCAGCAGCCAGGCAAAATGCAG-------------------------------------------------------
--------------------------------------------------CGGATTCACTTTGGAGCCACAGGAAAGCTGGCGTCCGCGGACATCGAA--
----CTCTTAGAAAAATCCAGGGTGACATTTCAGTTATCCAGTGAGAGAAGCTATCATATTTTTTATCAAATCATGTCAAACAAGAAGCCAGAACTC---
---CTGCTTCTCATCTCAACCAATCCCTTTGACTTCCCCTTCGTGAGCCAAGGAGAGGTCACCGTGGCCAGCATTGACGACAGTGAGGAGCTGTTGGCGA
CTGAT-----------------------------------------------------------------------------------------------
----------------------------------------------GCTGACAAAGCTGGGTACCTGATGGGTCTGAATTCTGCAGAAATGCTGAAAGGC
CTGTGCTGTCCAAGGGTGAAGGTCGGGAACGAATATGTCACTAAGGGACAAAATGTCCAGCAG-------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------GACT
CCGGGGGAAGCAAGAAGGGCGGGAAGAAGAAGGGATCCTCCTTCCAGACCGTGTCTGCTGTGTTCAGGGAAAATCTAAACAAACTGATGACCAATTTAAG
GAGCACTCACCCTCACTTTGTACGATGTCTGATTCCCAACGAGACCAAGACT------GTCATGNACCACCACCTGGTCATGCACCAGCTGCGCTGTAAC
GGGGTCCTGGAGGGCATCCGGATTTGCAGGAAAGGGTTCCCCAGCCGGATCCTCTATGCTGACTTCAAGCAG---TACCGAATCCTCAACGCCAGCGCCA
TCCCAGAGGGGCAGTTCATCGACAGCAAAAACGCTTCCGAGAAGCTTCTCAACTCCATCGACGTGGACCGGGAGCAGTACAGGTTCGGCCACACCAAGGT
GTTTTTCAAAGCTGGGCTCCTGGGACTCTTGGAGGAGATGAGGGACGAGAAGCTGGTGACCCTGATGACACGCACGCAGGCCGTGTGCCGGGGGTACCTG
ATGCGGATGGAGTTCAAGAAGATGCTGGAGCGG---GACTCCATCTTCTGCATCCAGTACAACATCCGAGCCTTCATGAACGTCAAGCACTGGCCCTGGA
TGAACCTGTTCTTCAAAATTAAGCCCCTGCTCAAGAGCGCGGAGGCGGAGAAAGAGATGGCCACCATGAAGGAGGACTTCGAGAGAACCAAGGAAGAACT
GGCCAGATCCGAGGCTCGCCGGAAGGAGCTGGAGGAGAAAATGGTAACCCTGCTCCAGGAAAAGAATGACCTCCAGTTGCAGGTCCAGTCTGAAACAGAA
AATCTGATGGACGCCGAGGAGCGATGTGAGGGGCTCATCAAAAGCAAGATTCAACTGGAGGCCAAAGTGAAGGAGCTGAACGAGAGGCTGGAAGAGGAGG
AGGAGGTGAACTCCGAGCTGGTTGCCAAGAAAAGGAACCTGGAAGATAAGTGCTCCTCCCTCAAAAGGGACATCGACGACCTGGAGCTGACGCTGGCCAA
GGTGGAGAAGGAGAAGCACGCCACGGAGAACAAGGTAAAGAATCTTTCTGAAGAAATGACAGCGCTGGAAGGAAACCTTTCCAAATTGACCAAAGAGAAG
AAATCTCTGCAGGAAGCCCATCAGCAAACACTGGATGACCTTCAGGTGGAAGAA----------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------AAGGAGTTTGAAATCAGTCAGTTGCAGACCAAGATTGACGAC
GAACAAGTTCACAGTCTGCAGCTGCAGAAGAAGATTAAAGAACTG-------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------AGTAACGTGGAaaGAGTGTGCCGgaCTGTGGAAGACCAATTCAATGAAATCAAAGCCAAGGA
TGAACAACAGACACAGTTGATCCATGACCTGAACATGCAGAAAGCAAGACTGCAGACCCAAAAT---GAGTTGAGCCACCAAGTGGAAGAGAAGGAGGTG
CTGATCTCACAGCTAACCAAGAACAAGCAAGCTCTCACCCAGCAGCTGGAGGAGCTTAAGAGGCAGCTGGAAGAAGAAACCAAG----------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------AAACAAAAGCTTGACGAGAG
TCAAGCCGAGTTGGAAGCGGCTCAGAAAGAGTCCAGGTCCCTCAGTACCGAAATCTTCAAGATGCGTAATGCCTACGAGGAGNTGGTGGATCAGTTAGAG
ACACTCAGACGGGAGAACAAAAATCTGCAA----------------------------------------------------------------------
--------------------------------------------------------------------------------------CTTGCGTGTCAGCT
AGAGCTGAACCAGGTAAAGTCCGAGCTGGACCGCAAGATCGCCGAGAAGGATGAAGAAATTGAGCAGCTGAAGAAAAACAGCCAGCGGGCAGCAGAGGCC
ACACAGAGCGTGCTGGATGCTGAGATCCGGAGCCGGAATGATGCTCTGAGGCTGAAGAAGAAGATGGAGGGAGACCTCAATGAGATGGAGATTCAGCTGG
GCCACTCCAACCGCCAGGTGGCAGAGACCCAGAAACACCTGCGCGCAGTGCAGGGCCAGCTCAAGGACTCCCAGCTGCACCTGGATGATGCCCAGAGGAG
CAATGAGGGCCTCAAGGAGCAGCTGGCCATCGTGGAACGCAGGAACGGCCTCTTGCTGGAGGAGCTGGAGGAGATGAAGGTGGCCCTGGAGCAGACAGAG
CGGACCCGCAAGCTGTCGGAGCAGGAGCTGCTGGACGCCAGTGACCGCGTGCAGCTCCTACACTCCCAG-------------------------------
--------------------------------------------------------------------------------------------------GC
CATGATGGCGGAGGAGCTGAAGAAGGAGCAGGACACCAGCGCGCACCTGGAGCGCATGAGGAAGAACATGGAGCAGACCATCAAggACCTGCAGCACCGG
CTGGACGAGGCCGAGCAGATCGCCCTCAAGGGCGGCAAGAAGCAGCTGCAGAAGCTGGAGGCCCGG----------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------GAGGAACAGGCCAACACCAACCTGTCCAAGTTC
CGCAAGGTGCAGCACGAGCTGGATGAGGCGGAGGAGCGGGCGGACATCGCTGAGTCCCAGGTCAACAAGCTTCGGGCC----------------------
--------------


>BGISUSP0000878143
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------GESGAGKTVNTKRVIQYFATIA
VTGDKKKEQQPGKMQ-----------------------------------RIHFGATGKLASADIE--LLEKSRVTFQLSSERSYHIFYQIMSNKKPEL-
-LLLISTNPFDFPFVSQGEVTVASIDDSEELLATD-----------------------------------------------ADKAGYLMGLNSAEMLKG
LCCPRVKVGNEYVTKGQNVQQ-------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------DSGGSKKGGKKKGSSFQTVSAVFRENLNKLMTNLRSTHPHFVRCLIPNETKT--VM-HHLVMHQLRCN
GVLEGIRICRKGFPSRILYADFKQ-YRILNASAIPEGQFIDSKNASEKLLNSIDVDREQYRFGHTKVFFKAGLLGLLEEMRDEKLVTLMTRTQAVCRGYL
MRMEFKKMLER-DSIFCIQYNIRAFMNVKHWPWMNLFFKIKPLLKSAEAEKEMATMKEDFERTKEELARSEARRKELEEKMVTLLQEKNDLQLQVQSETE
NLMDAEERCEGLIKSKIQLEAKVKELNERLEEEEEVNSELVAKKRNLEDKCSSLKRDIDDLELTLAKVEKEKHATENKVKNLSEEMTALEGNLSKLTKEK
KSLQEAHQQTLDDLQVEE--------------------------------------------------------------------KEFEISQLQTKIDD
EQVHSLQLQKKIKEL-------------------------------------------------------------------------------------
----------------------------------------------SNVERVCRTVEDQFNEIKAKDEQQTQLIHDLNMQKARLQTQN-ELSHQVEEKEV
LISQLTKNKQALTQQLEELKRQLEEETK------------------------------------------------------------------------
------------------------------------------------------------KQKLDESQAELEAAQKESRSLSTEIFKMRNAYEE-VDQLE
TLRRENKNLQ----------------------------------------------------LACQLELNQVKSELDRKIAEKDEEIEQLKKNSQRAAEA
TQSVLDAEIRSRNDALRLKKKMEGDLNEMEIQLGHSNRQVAETQKHLRAVQGQLKDSQLHLDDAQRSNEGLKEQLAIVERRNGLLLEELEEMKVALEQTE
RTRKLSEQELLDASDRVQLLHSQ-------------------------------------------AMMAEELKKEQDTSAHLERMRKNMEQTIKDLQHR
LDEAEQIALKGGKKQLQKLEAR-------------------------------------------------------------------EEQANTNLSKF
RKVQHELDEAEERADIAESQVNKLRA------------