Sequences
EST Library Info
csp1Spleen - RNA from China
fce2Foetus 100 days, cerebellum
lnt2Lymphatic nodule tracheobroncalis
mcp1Mammae, collostrum producing
pldo1Unavailable
relu1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000130713 (click for geneview)
Transcript ID ENST00000253010(link to ensembl)
Symbol EXOSC2
Localtion Chromosome:9:130598716:130609800:1 band: 9q34.12
Description Exosome complex exonuclease RRP4 (EC 3.1.13.-) (Ribosomal RNA processing protein 4) (Exosome component 2). [Source:Uniprot/SWISSPROT;Acc:Q13868]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--M--E--M--R--L--P--V--A--R--K--P--L--S--E--R--L--G--R--D--T--K--K--H--L--V--V--P--G--D--T--I--
ATGGCGATGGAGATGAGGCTTCCAGTGGCTCGCAAGCCTCTTAGCGAGAGACTGGGCCGCGACACTAAGAAACATCTAGTGGTGCCGGGGGATACAATCA
   :::::::::::::::::::: :: ::::::::::::::::::::::: ::::: ::::: ::::::::.::.::.::::::::::::::.::.::::
---GCGATGGAGATGAGGCTTCCTGTCGCTCGCAAGCCTCTTAGCGAGAGCCTGGGGCGCGAGACTAAGAAGCACCTGGTGGTGCCGGGGGACACGATCA
----A--M--E--M--R--L--P--V--A--R--K--P--L--S--E--S--L--G--R--E--T--K--K--H--L--V--V--P--G--D--T--I--

---------------------><-----------------------------------------------------------------------------
T--T--D--T--G--F--M--R--G--H--G--T--Y--M--G--E--E--K--L--I--A--S--V--A--G--S--V--E--R--V--N--K--L--I
CTACGGACACAGGATTCATGCGGGGCCATGGAACGTATATGGGAGAAGAGAAGCTCATTGCATCTGTTGCTGGCTCTGTGGAGAGAGTAAACAAGTTGAT
:.::::::::::: ::::::   ::::::::.:: ::::::::.::::::::::::::.::.::::: :::::::: ::::::::::::::::::.::::
CCACGGACACAGGCTTCATG---GGCCATGGGACCTATATGGGGGAAGAGAAGCTCATCGCGTCTGTGGCTGGCTCGGTGGAGAGAGTAAACAAGCTGAT
T--T--D--T--G--F--M-----G--H--G--T--Y--M--G--E--E--K--L--I--A--S--V--A--G--S--V--E--R--V--N--K--L--I

-----------------------><--------------------------------------------><-----------------------------
--C--V--K--A--L--K--T--R--Y--I--G--E--V--G--D--I--V--V--G--R--I--T--E--V--Q--Q--K--R--W--K--V--E--T-
CTGTGTGAAAGCTTTGAAAACCAGATACATTGGTGAAGTAGGAGACATCGTAGTGGGACGAATCACAGAGGTTCAACAGAAGAGGTGGAAGGTGGAGACC
::::::.:::::::::::::::                                                ::.:::::::::::::::::.:::::::::
CTGTGTAAAAGCTTTGAAAACC------------------------------------------------GTCCAACAGAAGAGGTGGAAAGTGGAGACC
--C--V--K--A--L--K--T--------------------------------------------------V--Q--Q--K--R--W--K--V--E--T-

-----------------------------------------------------------><---------------------------------------
-N--S--R--L--D--S--V--L--L--L--S--S--M--N--L--P--G--G--E--L--R--R--R--S--A--E--D--E--L--A--M--R--G--
AACTCCAGGCTGGATTCGGTCTTGCTGCTCTCGTCCATGAACCTTCCTGGAGGAGAGCTGAGGAGAAGATCTGCAGAAGATGAGCTTGCAATGAGAGGTT
::::::::::::::.::::::.:::: :: ::.::::::::::::::.::::::::::::::::::::::: :::::.::.::::: ::.:::::.::.:
AACTCCAGGCTGGACTCGGTCCTGCTTCTGTCATCCATGAACCTTCCCGGAGGAGAGCTGAGGAGAAGATCGGCAGAGGACGAGCTGGCGATGAGGGGCT
-N--S--R--L--D--S--V--L--L--L--S--S--M--N--L--P--G--G--E--L--R--R--R--S--A--E--D--E--L--A--M--R--G--

-------------------------><-------------------------------------------------------------------><----
F--L--Q--E--G--D--L--I--S--A--E--V--Q--A--V--F--S--D--G--A--V--S--L--H--T--R--S--L--K--Y--G--K--L--G
TCTTACAGGAAGGGGACCTTATCAGTGCTGAGGTCCAGGCAGTGTTCTCTGACGGAGCTGTCTCTTTGCACACGAGGAGCCTGAAATATGGAAAACTAGG
::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::.:::::::::::::.:: :::::.::::::::.::
TCTTGCAGGAAGGGGACCTTATCAGTGCTGAGGTCCAGGCAGTGTTCTCTGACGGAGCCGTCTCTCTGCACACGAGGAGTCTCAAATACGGAAAACTGGG
F--L--Q--E--G--D--L--I--S--A--E--V--Q--A--V--F--S--D--G--A--V--S--L--H--T--R--S--L--K--Y--G--K--L--G

----------------------------------------------------------------------------------------------------
--Q--G--V--L--V--Q--V--S--P--S--L--V--K--R--Q--K--T--H--F--H--D--L--P--C--G--A--S--V--I--L--G--N--N-
TCAGGGGGTTTTGGTCCAGGTTTCCCCCTCCCTGGTGAAACGGCAGAAGACCCACTTTCATGATTTGCCATGTGGTGCCTCAGTGATTCTCGGTAACAAC
:::::: :: : :::.::::::::::::::::::::.::::::::::::::.:::::.:::::..::::::::::::::::::::::::: ::.::::::
TCAGGGCGTATGGGTTCAGGTTTCCCCCTCCCTGGTAAAACGGCAGAAGACTCACTTCCATGACCTGCCATGTGGTGCCTCAGTGATTCTGGGCAACAAC
--Q--G--V--W--V--Q--V--S--P--S--L--V--K--R--Q--K--T--H--F--H--D--L--P--C--G--A--S--V--I--L--G--N--N-

-----------------------------------------------------------------------><---------------------------
-G--F--I--W--I--Y--P--T--P--E--H--K--E--E--E--A--G--G--F--I--A--N--L--E--P--V--S--L--A--D--R--E--V--
GGCTTCATCTGGATTTACCCAACACCTGAGCACAAAGAAGAGGAAGCAGGGGGCTTCATTGCAAACCTGGAGCCTGTCTCTCTTGCTGATCGAGAGGTGA
::::::::::::::.::::::::.::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::
GGCTTCATCTGGATCTACCCAACGCCTGAGCACAAAGAGGAGGAGGCAGGGGGCTTCATTGCAAACCTGGAGCCTGTCTCCCTTGCTGATCGAGAGGTGA
-G--F--I--W--I--Y--P--T--P--E--H--K--E--E--E--A--G--G--F--I--A--N--L--E--P--V--S--L--A--D--R--E--V--

----------------------------------------------------------------------------------------------------
I--S--R--L--R--N--C--I--I--S--L--V--T--Q--R--M--M--L--Y--D--T--S--I--L--Y--C--Y--E--A--S--L--P--H--Q
TATCCCGGCTTCGGAACTGCATCATCTCGCTGGTAACTCAGAGGATGATGCTGTATGATACCAGCATCCTGTACTGCTATGAAGCATCCCTTCCACATCA
: :::::::: ::::::::::::.:::::::::: ::.::::::.::::::::::::::::::::::::::::::::::.::.:::::::::::::::::
TTTCCCGGCTGCGGAACTGCATCGTCTCGCTGGTCACCCAGAGGGTGATGCTGTATGATACCAGCATCCTGTACTGCTACGAGGCATCCCTTCCACATCA
I--S--R--L--R--N--C--I--V--S--L--V--T--Q--R--V--M--L--Y--D--T--S--I--L--Y--C--Y--E--A--S--L--P--H--Q

><------------------------------------------------------------------------------->
--I--K--D--I--L--K--P--E--I--M--E--E--I--V--M--E--T--R--Q--R--L--L--E--Q--E--G--*-
GATCAAAGACATCTTAAAGCCAGAAATAATGGAGGAGATTGTGATGGAAACACGCCAGAGGCTTTTGGAACAGGAGGGATAA
:::::::::::::::::::::::::.::::::::::.:::::::::::.:::::::::::::::.:::::::::::::.:::
GATCAAAGACATCTTAAAGCCAGAAGTAATGGAGGAAATTGTGATGGAGACACGCCAGAGGCTTCTGGAACAGGAGGGGTAA
--I--K--D--I--L--K--P--E--V--M--E--E--I--V--M--E--T--R--Q--R--L--L--E--Q--E--G--*-

Pig Consensus Sequence

>BGISUST0000895388
---GCGATGGAGATGAGGCTTCCTGTCGCTCGCAAGCCTCTTAGCGAGAGCCTGGGGCGCGAGACTAAGAAGCACCTGGTGGTGCCGGGGGACACGATCA
CCACGGACACAGGCTTCATG---GGCCATGGGACCTATATGGGGGAAGAGAAGCTCATCGCGTCTGTGGCTGGCTCGGTGGAGAGAGTAAACAAGCTGAT
CTGTGTAAAAGCTTTGAAAACC------------------------------------------------GTCCAACAGAAGAGGTGGAAAGTGGAGACC
AACTCCAGGCTGGACTCGGTCCTGCTTCTGTCATCCATGAACCTTCCCGGAGGAGAGCTGAGGAGAAGATCGGCAGAGGACGAGCTGGCGATGAGGGGCT
TCTTGCAGGAAGGGGACCTTATCAGTGCTGAGGTCCAGGCAGTGTTCTCTGACGGAGCCGTCTCTCTGCACACGAGGAGTCTCAAATACGGAAAACTGGG
TCAGGGCGTATGGGTTCAGGTTTCCCCCTCCCTGGTAAAACGGCAGAAGACTCACTTCCATGACCTGCCATGTGGTGCCTCAGTGATTCTGGGCAACAAC
GGCTTCATCTGGATCTACCCAACGCCTGAGCACAAAGAGGAGGAGGCAGGGGGCTTCATTGCAAACCTGGAGCCTGTCTCCCTTGCTGATCGAGAGGTGA
TTTCCCGGCTGCGGAACTGCATCGTCTCGCTGGTCACCCAGAGGGTGATGCTGTATGATACCAGCATCCTGTACTGCTACGAGGCATCCCTTCCACATCA
GATCAAAGACATCTTAAAGCCAGAAGTAATGGAGGAAATTGTGATGGAGACACGCCAGAGGCTTCTGGAACAGGAGGGGTAA


>BGISUSP0000895388
-AMEMRLPVARKPLSESLGRETKKHLVVPGDTITTDTGFM-GHGTYMGEEKLIASVAGSVERVNKLICVKALKT----------------VQQKRWKVET
NSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVWVQVSPSLVKRQKTHFHDLPCGASVILGNN
GFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIVSLVTQRVMLYDTSILYCYEASLPHQIKDILKPEVMEEIVMETRQRLLEQEG*