Sequences
EST Library Info
cli2Liver - RNA from China
plun3Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000131187 (click for geneview)
Transcript ID ENST00000253496(link to ensembl)
Symbol F12
Localtion Chromosome:5:176761747:176769183:-1 band: 5q35.3
Description Coagulation factor XII precursor (EC 3.4.21.38) (Hageman factor) (HAF). [Source:Uniprot/SWISSPROT;Acc:P00748]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------><------------------------------------------
-M--R--A--L--L--L--L--G--F--L--L--V--S--L--E--S--T--L--S--I--P--P--W--E--A--P--K--E--H--K--Y--K--A--
ATGAGGGCTCTGCTGCTCCTGGGGTTCCTGCTGGTGAGCTTGGAGTCAACACTTTCGATTCCACCTTGGGAAGCCCCCAAGGAGCATAAGTACAAAGCTG
::::::::::::::::::.::::: ::::::::::::::.::::::::.: :::                                              
ATGAGGGCTCTGCTGCTCTTGGGGATCCTGCTGGTGAGCCTGGAGTCAGCTCTT----------------------------------------------
-M--R--A--L--L--L--L--G--I--L--L--V--S--L--E--S--A--L-----------------------------------------------

--------------><------------------------------------------------------------------------------------
E--E--H--T--V--V--L--T--V--T--G--E--P--C--H--F--P--F--Q--Y--H--R--Q--L--Y--H--K--C--T--H--K--G--R--P
AAGAGCACACAGTCGTTCTCACTGTCACCGGGGAGCCCTGCCACTTCCCCTTCCAGTACCACCGGCAGCTGTACCACAAATGTACCCACAAGGGCCGGCC
                 :::::.::::: :::::::::::.::::::::::::::::::::::::::::::::..::::.::.:.::: :..::::.:: 
-----------------CTCACCGTCACGGGGGAGCCCTGTCACTTCCCCTTCCAGTACCACCGGCAGCTGTATTACAAGTGCATCCAAAGAGGCCAGCG
------------------L--T--V--T--G--E--P--C--H--F--P--F--Q--Y--H--R--Q--L--Y--Y--K--C--I--Q--R--G--Q--R

--------------><---------------------------------------------------------------------><-------------
--G--P--Q--P--W--C--A--T--T--P--N--F--D--Q--D--Q--R--W--G--Y--C--L--E--P--K--K--V--K--D--H--C--S--K-
AGGCCCTCAGCCCTGGTGTGCTACCACCCCCAACTTTGATCAGGACCAGCGATGGGGATACTGTTTGGAGCCCAAGAAAGTGAAAGACCACTGCAGCAAA
 :::::.:..:::   :::::::: :::::::::::.::  ::::::::::::::: ::::::..::::::::: ::::::::::   :::::::.::::
TGGCCCCCGACCC---TGTGCTACAACCCCCAACTTCGAGAAGGACCAGCGATGGGCATACTGCCTGGAGCCCATGAAAGTGAAA---CACTGCAACAAA
--G--P--R--P-----C--A--T--T--P--N--F--E--K--D--Q--R--W--A--Y--C--L--E--P--M--K--V--K-----H--C--N--K-

------------------------------------------------------------------------------------------------><--
-H--S--P--C--Q--K--G--G--T--C--V--N--M--P--S--G--P--H--C--L--C--P--Q--H--L--T--G--N--H--C--Q--K--E--
CACAGCCCCTGCCAGAAAGGAGGGACCTGTGTGAACATGCCAAGCGGCCCCCACTGTCTCTGTCCACAACACCTCACTGGAAACCACTGCCAGAAAGAGA
 .::.::::::::::::::::::::::::::::::::::::::..::::: :::::. :::::::: : :::.:::::::.:: :::::.::::::    
GGCAACCCCTGCCAGAAAGGAGGGACCTGTGTGAACATGCCAAATGGCCCACACTGCATCTGTCCAGATCACTTCACTGGGAAGCACTGTCAGAAA----
-G--N--P--C--Q--K--G--G--T--C--V--N--M--P--N--G--P--H--C--I--C--P--D--H--F--T--G--K--H--C--Q--K-----

----------------------------------------------------------------------------------------------------
K--C--F--E--P--Q--L--L--R--F--F--H--K--N--E--I--W--Y--R--T--E--Q--A--A--V--A--R--C--Q--C--K--G--P--D
AGTGCTTTGAGCCTCAGCTTCTCCGGTTTTTCCACAAGAATGAGATATGGTATAGAACTGAGCAAGCAGCTGTGGCCAGATGCCAGTGCAAGGGTCCTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------><----------------------------------------------------------------------
--A--H--C--Q--R--L--A--S--Q--A--C--R--T--N--P--C--L--H--G--G--R--C--L--E--V--E--G--H--R--L--C--H--C-
TGCCCACTGCCAGCGGCTGGCCAGCCAGGCCTGCCGCACCAACCCGTGCCTCCATGGGGGTCGCTGCCTAGAGGTGGAGGGCCACCGCCTGTGCCACTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------><-----------------------------------------------------------------
-P--V--G--Y--T--G--A--F--C--D--V--D--T--K--A--S--C--Y--D--G--R--G--L--S--Y--R--G--L--A--R--T--T--L--
CCGGTGGGCTACACCGGAGCCTTCTGCGACGTGGACACCAAGGCAAGCTGCTATGATGGCCGCGGGCTCAGCTACCGCGGCCTGGCCAGGACCACGCTCT
                                     .::::: .:: :::::...::.::: :::::::::::::::::: ::::: .:::.:::::::
------------------------------------CTCAAGGAGAGGTGCTACAGTGACCGGGGGCTCAGCTACCGCGGCATGGCCCAGACTACGCTCT
-------------------------------------L--K--E--R--C--Y--S--D--R--G--L--S--Y--R--G--M--A--Q--T--T--L--

--------------------------------------------------------------------------------------------------->
S--G--A--P--C--Q--P--W--A--S--E--A--T--Y--R--N--V--T--A--E--Q--A--R--N--W--G--L--G--G--H--A--F--C--R
CGGGTGCGCCCTGTCAGCCGTGGGCCTCGGAGGCCACCTACCGGAACGTGACTGCCGAGCAAGCGCGGAACTGGGGACTGGGCGGCCACGCCTTCTGCCG
:::: ::.:::::::::::::::::::::::::::::::::.:::::.::::.:: :::::::: : ::::::::::::::: :.:::.:::::::::  
CGGGAGCACCCTGTCAGCCGTGGGCCTCGGAGGCCACCTACTGGAACATGACCGCAGAGCAAGCTCTGAACTGGGGACTGGGAGACCATGCCTTCTGC--
S--G--A--P--C--Q--P--W--A--S--E--A--T--Y--W--N--M--T--A--E--Q--A--L--N--W--G--L--G--D--H--A--F--C---

<---------------------------------------------------------------------------------------------------
--N--P--D--N--D--I--R--P--W--C--F--V--L--N--R--D--R--L--S--W--E--Y--C--D--L--A--Q--C--Q--T--P--T--Q-
GAACCCGGACAACGACATCCGCCCGTGGTGCTTCGTGCTGAACCGCGACCGGCTGAGCTGGGAGTACTGCGACCTGGCACAGTGCCAGACCCCAACCCAG
 ::::::::::::::::.:::::::::::::::::: . ::.  ::::::..::::::::: :.                                    
-AACCCGGACAACGACACCCGCCCGTGGTGCTTCGTTTGGAGAGGCGACCAACTGAGCTGGCAA------------------------------------
--N--P--D--N--D--T--R--P--W--C--F--V--W--R--G--D--Q--L--S--W--Q-------------------------------------

----------------------------------------------------------------------------------------------------
-A--A--P--P--T--P--V--S--P--R--L--H--V--P--L--M--P--A--Q--P--A--P--P--K--P--Q--P--T--T--R--T--P--P--
GCGGCGCCTCCGACCCCGGTGTCCCCTAGGCTTCATGTCCCACTCATGCCCGCGCAGCCGGCACCGCCGAAGCCTCAGCCCACGACCCGGACCCCGCCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------><---------------------------------------------------------------------------------
Q--S--Q--T--P--G--A--L--P--A--K--R--E--Q--P--P--S--L--T--R--N--G--P--L--S--C--G--Q--R--L--R--K--S--L
AGTCCCAGACCCCGGGAGCCTTGCCGGCGAAGCGGGAGCAGCCGCCTTCCCTGACCAGGAACGGCCCACTGAGCTGCGGGCAGCGGCTCCGCAAGAGTCT
                                ::: ::::::    :.:.::: :::: .  ::::.. ::.:::::::.:::::.::::::::. : ::
--------------------------------CGGTAGCAGCGTGGTCCTCTGCCCAGTGCGGGCCTGGTGGGCTGCGGACAGCGACTCCGCAAACGGCT
---------------------------------R--*--Q--R--G--P--L--P--S--A--G--L--V--G--C--G--Q--R--L--R--K--R--L

----------------------------------------------------------------------------------------------------
--S--S--M--T--R--V--V--G--G--L--V--A--L--R--G--A--H--P--Y--I--A--A--L--Y--W--G--H--S--F--C--A--G--S-
GTCTTCGATGACCCGCGTCGTTGGCGGGCTGGTGGCGCTACGCGGGGCGCACCCCTACATCGCCGCGCTGTACTGGGGCCACAGTTTCTGCGCCGGCAGC
::::::  ::: ::::.::::.:: ::.:::::::: :: : ::::::::::::::::::::::::::::::::::::.:: :.::::::::: :::::.
GTCTTCTCTGAACCGCATCGTCGGGGGACTGGTGGCTCTCCCCGGGGCGCACCCCTACATCGCCGCGCTGTACTGGGGTCAAAATTTCTGCGCAGGCAGT
--S--S--L--N--R--I--V--G--G--L--V--A--L--P--G--A--H--P--Y--I--A--A--L--Y--W--G--Q--N--F--C--A--G--S-

-----------------------------------------------><---------------------------------------------------
-L--I--A--P--C--W--V--L--T--A--A--H--C--L--Q--D--P--A--P--E--D--L--T--V--V--L--G--Q--E--R--R--N--H--
CTCATCGCCCCCTGCTGGGTGCTGACGGCCGCTCACTGCCTGCAGGACCCCGCACCCGAGGATCTGACGGTGGTGCTCGGCCAGGAACGCCGTAACCACA
::::::::::::::.::::::::::: :: :::::::::::::::.::   ::.:: ::::: ::::: ::::::::::::::::: ::::.:::.:: :
CTCATCGCCCCCTGTTGGGTGCTGACCGCGGCTCACTGCCTGCAGAAC---GCGCCGGAGGAGCTGACTGTGGTGCTCGGCCAGGACCGCCATAATCAGA
-L--I--A--P--C--W--V--L--T--A--A--H--C--L--Q--N-----A--P--E--E--L--T--V--V--L--G--Q--D--R--H--N--Q--

-----------------------------------------------------------------------------------><---------------
S--C--E--P--C--Q--T--L--A--V--R--S--Y--R--L--H--E--A--F--S--P--V--S--Y--Q--H--D--L--A--L--L--R--L--Q
GCTGTGAGCCGTGCCAGACGTTGGCCGTGCGCTCCTACCGCTTGCACGAGGCCTTCTCGCCCGTCAGCTACCAGCACGACCTGGCTCTGTTGCGCCTTCA
:.::::::: ::::::.:::.:::: :::::::::::::::.:::::::: ::: :::.:::.  : ::::::::::::::::                 
GTTGTGAGCAGTGCCAAACGCTGGCAGTGCGCTCCTACCGCCTGCACGAGTCCTACTCACCCAAGACCTACCAGCACGACCTG-----------------
S--C--E--Q--C--Q--T--L--A--V--R--S--Y--R--L--H--E--S--Y--S--P--K--T--Y--Q--H--D--L------------------

----------------------------------------------------------------------------------------------------
--E--D--A--D--G--S--C--A--L--L--S--P--Y--V--Q--P--V--C--L--P--S--G--A--A--R--P--S--E--T--T--L--C--Q-
GGAGGATGCGGACGGCAGCTGCGCGCTCCTGTCGCCTTACGTTCAGCCGGTGTGCCTGCCAAGCGGCGCCGCGCGACCCTCCGAGACCACGCTCTGCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------><-----------------------------------------------------------------------
-V--A--G--W--G--H--Q--F--E--G--A--E--E--Y--A--S--F--L--Q--E--A--Q--V--P--F--L--S--L--E--R--C--S--A--
GTGGCCGGCTGGGGCCACCAGTTCGAGGGGGCGGAGGAATATGCCAGCTTCCTGCAGGAGGCGCAGGTACCGTTCCTCTCCCTGGAGCGCTGCTCAGCCC
                              :.:::::::::: ::::.:::::::::::::: :::::.:::.:: ::  .:.:::::::::::: ::: 
------------------------------GTGGAGGAATATTCCAGTTTCCTGCAGGAGGCTCAGGTGCCGCTCATCAGTCCGGAGCGCTGCTCCGCCG
-------------------------------V--E--E--Y--S--S--F--L--Q--E--A--Q--V--P--L--I--S--P--E--R--C--S--A--

----------------------------------------------------------------------------><----------------------
P--D--V--H--G--S--S--I--L--P--G--M--L--C--A--G--F--L--E--G--G--T--D--A--C--Q--G--D--S--G--G--P--L--V
CGGACGTGCACGGATCCTCCATCCTCCCCGGCATGCTCTGCGCAGGGTTCCTCGAGGGCGGCACCGATGCGTGCCAGGGTGATTCCGGAGGCCCGCTGGT
: :::::::::::: :: :. :: ..::::::::::::::::: :: ::::::::.:::::::::::.:::::::::                       
CCGACGTGCACGGAGCCGCTTTCACTCCCGGCATGCTCTGCGCTGGTTTCCTCGAAGGCGGCACCGACGCGTGCCAG-----------------------
A--D--V--H--G--A--A--F--T--P--G--M--L--C--A--G--F--L--E--G--G--T--D--A--C--Q------------------------

----------------------------------------------------------------------------------------------------
--C--E--D--Q--A--A--E--R--R--L--T--L--Q--G--I--I--S--W--G--S--G--C--G--D--R--N--K--P--G--V--Y--T--D-
GTGTGAGGACCAAGCTGCAGAGCGCCGGCTCACCCTGCAAGGCATCATCAGCTGGGGATCGGGCTGTGGTGACCGCAACAAGCCAGGCGTCTACACCGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------->
-V--A--Y--Y--L--A--W--I--R--E--H--T--V--S--*-
GTGGCCTACTACCTGGCCTGGATCCGGGAGCACACCGTTTCCTGA
                                             
---------------------------------------------
---------------------------------------------

Pig Consensus Sequence

>BGISUST0000876737
ATGAGGGCTCTGCTGCTCTTGGGGATCCTGCTGGTGAGCCTGGAGTCAGCTCTT----------------------------------------------
-----------------CTCACCGTCACGGGGGAGCCCTGTCACTTCCCCTTCCAGTACCACCGGCAGCTGTATTACAAGTGCATCCAAAGAGGCCAGCG
TGGCCCCCGACCC---TGTGCTACAACCCCCAACTTCGAGAAGGACCAGCGATGGGCATACTGCCTGGAGCCCATGAAAGTGAAA---CACTGCAACAAA
GGCAACCCCTGCCAGAAAGGAGGGACCTGTGTGAACATGCCAAATGGCCCACACTGCATCTGTCCAGATCACTTCACTGGGAAGCACTGTCAGAAA----
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------CTCAAGGAGAGGTGCTACAGTGACCGGGGGCTCAGCTACCGCGGCATGGCCCAGACTACGCTCT
CGGGAGCACCCTGTCAGCCGTGGGCCTCGGAGGCCACCTACTGGAACATGACCGCAGAGCAAGCTCTGAACTGGGGACTGGGAGACCATGCCTTCTGC--
-AACCCGGACAACGACACCCGCCCGTGGTGCTTCGTTTGGAGAGGCGACCAACTGAGCTGGCAA------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------CGGTAGCAGCGTGGTCCTCTGCCCAGTGCGGGCCTGGTGGGCTGCGGACAGCGACTCCGCAAACGGCT
GTCTTCTCTGAACCGCATCGTCGGGGGACTGGTGGCTCTCCCCGGGGCGCACCCCTACATCGCCGCGCTGTACTGGGGTCAAAATTTCTGCGCAGGCAGT
CTCATCGCCCCCTGTTGGGTGCTGACCGCGGCTCACTGCCTGCAGAAC---GCGCCGGAGGAGCTGACTGTGGTGCTCGGCCAGGACCGCCATAATCAGA
GTTGTGAGCAGTGCCAAACGCTGGCAGTGCGCTCCTACCGCCTGCACGAGTCCTACTCACCCAAGACCTACCAGCACGACCTG-----------------
----------------------------------------------------------------------------------------------------
------------------------------GTGGAGGAATATTCCAGTTTCCTGCAGGAGGCTCAGGTGCCGCTCATCAGTCCGGAGCGCTGCTCCGCCG
CCGACGTGCACGGAGCCGCTTTCACTCCCGGCATGCTCTGCGCTGGTTTCCTCGAAGGCGGCACCGACGCGTGCCAG-----------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------


>BGISUSP0000876737
MRALLLLGILLVSLESAL---------------------LTVTGEPCHFPFQYHRQLYYKCIQRGQRGPRP-CATTPNFEKDQRWAYCLEPMKVK-HCNK
GNPCQKGGTCVNMPNGPHCICPDHFTGKHCQK--------------------------------------------------------------------
------------LKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFC-NPDNDTRPWCFVWRGDQLSWQ------------
--------------------------------------------R*QRGPLPSAGLVGCGQRLRKRLSSLNRIVGGLVALPGAHPYIAALYWGQNFCAGS
LIAPCWVLTAAHCLQN-APEELTVVLGQDRHNQSCEQCQTLAVRSYRLHESYSPKTYQHDL---------------------------------------
----------VEEYSSFLQEAQVPLISPERCSAADVHGAAFTPGMLCAGFLEGGTDACQ-----------------------------------------
---------------