Sequences
EST Library Info
cad1Unavailable
che1Heart - RNA from China
cje1Jejunum - RNA from China
cki2Kidney - RNA from China
cli3Liver - RNA from China
cov2Ovary - RNA from China
csp4Spleen - RNA from China
cut2Uterus - RNA from China
ecc1Foetus 50 days, cortex cerebri
eep2Foetus 50 days, epidermis
eje3Foetus 50 days, jejunum
elu1Foetus 50 days, lung
eru4Foetus 50 days, regio umbilicalis
ese2Foetus 50 days, M. semitendinosus
eye3Foetus 50 days, Eye
fbs1Unavailable
fcc1Unavailable
fce1Foetus 100 days, cerebellum
hea2Heart
hyp1Hypothalamus
jej2Small intestine, jejunum
lnt4Lymphatic nodule tracheobroncalis
mcp3Mammae, collostrum producing
med5Mediastinum
mgp1Mammary gland - 7 days pre birth
nbm3Newborn 115 days, bone marrow (pelvis)
nca1Newborn 115 days, cartillage
nco2Newborn 115 days, colon
nmm1Newborn 115 days, mucosal membranes
pgl2Pituitary gland
relu4Unavailable
ssp1M. Supraspinatus
ute1Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000089280 (click for geneview)
Transcript ID ENST00000254108(link to ensembl)
Symbol FUS
Localtion Chromosome:16:31098960:31110424:1 band: 16p11.2
Description RNA-binding protein FUS (Oncogene FUS) (Oncogene TLS) (Translocated in liposarcoma protein) (POMp75) (75 kDa DNA-pairing protein). [Source:Uniprot/SWISSPROT;Acc:P35637]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------><-----------------------><-------------------------------------------------------------
-M--A--S--N--D--Y--T--Q--Q--A--T--Q--S--Y--G--A--Y--P--T--Q--P--G--Q--G--Y--S--Q--Q--S--S--Q--P--Y--
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACG
                                       ::.::::::::::::::::::::.:::::.:::::::::::::::::::..::::::::::
---------------------------------------TACGGGGCCTACCCCACCCAGCCTGGGCAAGGCTATTCCCAGCAGAGCAACCAGCCCTACG
----------------------------------------Y--G--A--Y--P--T--Q--P--G--Q--G--Y--S--Q--Q--S--N--Q--P--Y--

--------------------------------------------------------------------------------------------><------
G--Q--Q--S--Y--S--G--Y--S--Q--S--T--D--T--S--G--Y--G--Q--S--S--Y-----S--S--Y--G--Q--S--Q--N--T--G--Y
GACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTAT---TCTTCTTATGGCCAGAGCCAGAACACAGGCTA
::::::::::::::::.:::::..::::::: .::::::::::::::::::::::::::::::::     ::::::::: :::: :::::::   :::::
GACAGCAGAGTTACAGCGGTTACGGCCAGTCAGCGGACACTTCAGGCTATGGCCAGAGCAGCTATGGCAGTTCTTATGGACAGACCCAGAAC---GGCTA
G--Q--Q--S--Y--S--G--Y--G--Q--S--A--D--T--S--G--Y--G--Q--S--S--Y--G--S--S--Y--G--Q--T--Q--N-----G--Y

----------------------------------------------------------------------------------------------------
--G--T--Q--S--T--P--Q--G--Y--G--S--T--G--G--Y--G--S--S--Q--S--S--Q--S--S--Y--G--Q--Q--S--S--Y--P--G-
TGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGGC
::: :: ::::::.:::::::::::::::::::..::::.::::::::..::::::::.:.::.:::::::::::::::::::::::.:: :::::::::
TGGCACACAGTCAGCTCCCCAGGGATATGGCTCAGCTGGTGGCTATGGTGGTAGCCAGGGTTCTCAATCGTCTTACGGGCAGCAGTCTTCATACCCTGGC
--G--T--Q--S--A--P--Q--G--Y--G--S--A--G--G--Y--G--G--S--Q--G--S--Q--S--S--Y--G--Q--Q--S--S--Y--P--G-

-------------------------------------><-------------------------------------------------------------
-Y--G--Q--Q--P--A--P--S--S--T--S--G--S--Y--G--S--S--S--Q--S--S--S--Y--G--Q--P--Q--S--G--S--Y--S--Q--
TATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGC
::::::::::::::::::::.:::::::::::::::   ::.:::: .::::: ::::::::..:::::::::::::::::::::::.::::..::::::
TATGGCCAGCAGCCAGCTCCTAGCAGCACCTCGGGA---TATGGTACTAGTTCGCAGAGCAGTGGCTATGGGCAGCCCCAGAGTGGGGGCTATGGCCAGC
-Y--G--Q--Q--P--A--P--S--S--T--S--G-----Y--G--T--S--S--Q--S--S--G--Y--G--Q--P--Q--S--G--G--Y--G--Q--

----------------------------------------------------------------------------------------------------
Q--P--S--Y--G--G--Q--Q--Q--S--Y--G--Q--Q--Q--S--Y--N--P--P--Q--G--Y--G--Q--Q--N--Q--Y--N--S--S--S--G
AGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGG
:..::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::
AATCTGGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGTAGCAGTGG
Q--S--G--Y--G--G--Q--Q--Q--S--Y--G--Q--Q--Q--S--Y--N--P--P--Q--G--Y--G--Q--Q--N--Q--Y--N--S--S--S--G

-------------------------><-------------------------------------------------------------------------
--G--G--G--G--G--G--G--G--G--N--Y--G--Q--D--Q--S--S--M--S--S--G--G--G--S--G--G--G--Y--G--N--Q--D--Q-
TGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAG
.::::: :: ::.::::: ::                                                                               
CGGTGGTGGAGGGGGTGGCGGA------------------------------------------------------------------------------
--G--G--G--G--G--G--G-------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--G--G--G--G--S--G--G--Y--G--Q--Q--D--R--G--G--R--G--R--G--G--S--G--G--G--G--G--G--G--G--G--G--Y--
AGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACA
                                 :::::::::::.:::::.::: ::            :::::::::.::::.::::::::::::::::
---------------------------------CAGGACCGTGGGGGCCGTGGCCGG------------GGCGGCGGCAGCGGTGGCGGTGGTGGTTACA
----------------------------------Q--D--R--G--G--R--G--R--------------G--G--G--S--G--G--G--G--G--Y--

------------------------------------------------------------------><--------------------------------
N--R--S--S--G--G--Y--E--P--R--G--R--G--G--G--R--G--G--R--G--G--M--G--G--S--D--R--G--G--F--N--K--F--G
ACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGG
::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::.::::::   ::::::::::::::::::::::::::::::::
ACCGCAGCAGTGGTGGCTATGAACCCAGAGGGCGTGGAGGTGGCCGTGGAGGCAGAGGCGGCATG---GGAAGTGACCGTGGTGGCTTCAATAAATTTGG
N--R--S--S--G--G--Y--E--P--R--G--R--G--G--G--R--G--G--R--G--G--M-----G--S--D--R--G--G--F--N--K--F--G

-><-------------------------------><----------------------------------------------------------------
--G--P--R--D--Q--G--S--R--H--D--S--E--Q--D--N--S--D--N--N--T--I--F--V--Q--G--L--G--E--N--V--T--I--E-
TGGCCCTCGGGACCAAGGATCACGTCATGACTCCGAACAGGATAATTCAGACAACAACACCATCTTTGTGCAAGGCCTGGGTGAGAATGTTACAATTGAG
:   :::::::::::::::::::::::::::                                 ::.::::::::::::::.::::::::::::::::::
T---CCTCGGGACCAAGGATCACGTCATGAC---------------------------------TTCGTGCAAGGCCTGGGCGAGAATGTTACAATTGAG
-----P--R--D--Q--G--S--R--H--D-----------------------------------F--V--Q--G--L--G--E--N--V--T--I--E-

--------------------------------------><------------------------------------------------------------
-S--V--A--D--Y--F--K--Q--I--G--I--I--K--T--N--K--K--T--G--Q--P--M--I--N--L--Y--T--D-----R--E--T--G--
TCTGTGGCTGATTACTTCAAGCAGATTGGTATTATTAAGACAAACAAGAAAACGGGACAGCCCATGATTAATTTGTACACAGAC---AGGGAAACTGGCA
::::::::::::::::::::::::::.:::::.:::::::::::.:::::.:::::::::::::::::::::.:::::::.:::    ::::::: ::::
TCTGTGGCTGATTACTTCAAGCAGATCGGTATCATTAAGACAAATAAGAAGACGGGACAGCCCATGATTAATCTGTACACGGACC--TGGGAAACAGGCA
-S--V--A--D--Y--F--K--Q--I--G--I--I--K--T--N--K--K--T--G--Q--P--M--I--N--L--Y--T--D--\--R--E--T--G--

-----------------------------------------------------------------------><---------------------------
K--L--K--G--E--A--T--V--S--F--D--D--P--P--S--A--K--A--A--I--D--W--F--D--G--K--E--F--S--G--N--P--I--K
AGCTGAAGGGAGAGGCAACGGTCTCTTTTGATGACCCACCTTCAGCTAAAGCAGCTATTGACTGGTTTGATGGTAAAGAATTCTCCGGAAATCCTATCAA
:::::::::::::::::::.:::::.:::::::::::::: :: :: :::::::: ::.::::::::::::   ::::::::::: ::.:::::::::::
AGCTGAAGGGAGAGGCAACAGTCTCCTTTGATGACCCACCGTCTGCGAAAGCAGCGATCGACTGGTTTGAT---AAAGAATTCTCGGGGAATCCTATCAA
K--L--K--G--E--A--T--V--S--F--D--D--P--P--S--A--K--A--A--I--D--W--F--D-----K--E--F--S--G--N--P--I--K

-------------------------------------------------------------------------><-------------------------
--V--S--F--A--T--R--R--A--D--F--N--R--G--G--G--N--G--R--G--G--R--G--R--G--G--P--M--G--R--G--G--Y--G-
GGTCTCATTTGCTACTCGCCGGGCAGACTTTAATCGGGGTGGTGGCAATGGTCGTGGAGGCCGAGGGCGAGGAGGACCCATGGGCCGTGGAGGCTATGGA
:::::::::::::::::: ::.::::::::.::::::::.:::::::::::::::::::::::::::::::::   ::::::::::::::.:::::.:::
GGTCTCATTTGCTACTCGGCGAGCAGACTTCAATCGGGGCGGTGGCAATGGTCGTGGAGGCCGAGGGCGAGGA---CCCATGGGCCGTGGGGGCTACGGA
--V--S--F--A--T--R--R--A--D--F--N--R--G--G--G--N--G--R--G--G--R--G--R--G-----P--M--G--R--G--G--Y--G-

-------------------------------------------------------------------------------------------------><-
-G--G--G--S--G--G--G--G--R--G--G--F--P--S--G--G--G--G--G--G--G--Q--Q--R--A--G--D--W--K--C--P--N--P--
GGTGGTGGCAGTGGTGGTGGTGGCCGAGGAGGATTTCCCAGTGGAGGTGGTGGCGGTGGAGGACAGCAGCGAGCTGGTGACTGGAAGTGTCCTAATCCCA
:::::::::::::::::.:::::::::::::::::.:::::::: ::.:::::::: :::::::::::::::::.:: ::::::::::::::::::   :
GGTGGTGGCAGTGGTGGCGGTGGCCGAGGAGGATTCCCCAGTGGCGGCGGTGGCGGAGGAGGACAGCAGCGAGCCGGGGACTGGAAGTGTCCTAAT---A
-G--G--G--S--G--G--G--G--R--G--G--F--P--S--G--G--G--G--G--G--G--Q--Q--R--A--G--D--W--K--C--P--N-----

--------------------------------------------------------------------------------------------------><
T--C--E--N--M--N--F--S--W--R--N--E--C--N--Q--C--K--A--P--K--P--D--G--P--G--G--G--P--G--G--S--H--M--G
CCTGTGAGAATATGAACTTCTCTTGGAGGAATGAATGCAACCAGTGTAAGGCCCCTAAACCAGATGGCCCAGGAGGGGGACCAGGTGGCTCTCACATGGG
: ::::::::.::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::: ::::::::.:::  
CGTGTGAGAACATGAACTTCTCTTGGAGGAATGAATGCAACCAGTGTAAGGCCCCCAAGCCAGATGGCCCAGGAGGGGGACCAGGAGGCTCTCATATG--
T--C--E--N--M--N--F--S--W--R--N--E--C--N--Q--C--K--A--P--K--P--D--G--P--G--G--G--P--G--G--S--H--M---

----------------------------------------------------------------------------------------------------
--G--N--Y--G--D--D--R--R--G--G--R--G--G--Y--D--R--G--G--Y--R--G--R--G--G--D--R--G--G--F--R--G--G--R-
GGGTAACTACGGGGATGATCGTCGTGGTGGCAGAGGAGGCTATGATCGAGGCGGCTACCGGGGCCGCGGCGGGGACCGTGGAGGCTTCCGAGGGGGCCGG
 ::.:.::::::.:::::::: :::::.:::::::: :::::::::::::::::::::::.::::: ::::::::::::::.::::::::::::::::::
-GGCAGCTACGGAGATGATCGGCGTGGCGGCAGAGGCGGCTATGATCGAGGCGGCTACCGAGGCCGAGGCGGGGACCGTGGGGGCTTCCGAGGGGGCCGG
--G--S--Y--G--D--D--R--R--G--G--R--G--G--Y--D--R--G--G--Y--R--G--R--G--G--D--R--G--G--F--R--G--G--R-

----------------------------------------------><-------------------------------------->
-G--G--G--D--R--G--G--F--G--P--G--K--M--D--S--R--G--E--H--R--Q--D--R--R--E--R--P--Y--*-
GGTGGTGGGGACAGAGGTGGCTTTGGCCCTGGCAAGATGGATTCCAGGGGTGAGCACAGACAGGATCGCAGGGAGAGGCCGTATTAA
:::::::::::::::::::::::::::::::::::::::::.:::   ::.::::::::::::::::: :::::::::::::::   
GGTGGTGGGGACAGAGGTGGCTTTGGCCCTGGCAAGATGGACTCC---GGCGAGCACAGACAGGATCGAAGGGAGAGGCCGTAT---
-G--G--G--D--R--G--G--F--G--P--G--K--M--D--S-----G--E--H--R--Q--D--R--R--E--R--P--Y----

Pig Consensus Sequence

>BGISUST0000885434
---------------------------------------TACGGGGCCTACCCCACCCAGCCTGGGCAAGGCTATTCCCAGCAGAGCAACCAGCCCTACG
GACAGCAGAGTTACAGCGGTTACGGCCAGTCAGCGGACACTTCAGGCTATGGCCAGAGCAGCTATGGCAGTTCTTATGGACAGACCCAG---GGCTATGG
CACACAGTCAGCTCCCCAGGGATATGGCTCAGCTGGTGGCTATGGTGGTAGCCAGGGTTCTCAATCGTCTTACGGGCAGCAGTCTTCATACCCTGGCTAT
GGCCAGCAGCCAGCTCCTAGCAGCACCTCGGGA---TATGGTACTAGTTCGCAGAGCAGTGGCTATGGGCAGCCCCAGAGTGGGGGCTATGGCCAGCAAT
CTGGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGTAGCAGTGGCGG
TGGTGGAGGGGGTGGCGGA---------------------------------------------------------------------------------
------------------------------CAGGACCGTGGGGGCCGTGGCCGGGGCGGCGGCAGCGGTGGCGGTGGTGGTTACAACCGCAGCAGTGGTG
GCTATGAACCCAGAGGGCGTGGAGGTGGCCGTGGAGGCAGAGGCGGCATG---GGAAGTGACCGTGGTGGCTTCAATAAATTTGGT---CCTCGGGACCA
AGGATCACGTCATGAC---------------------------------TTCGTGCAAGGCCTGGGCGAGAATGTTACAATTGAGTCTGTGGCTGATTAC
TTCAAGCAGATCGGTATCATTAAGACAAATAAGAAGACGGGACAGCCCATGATTAATCTGTACACGGActGGGAAACAGGCAAGCTGAAGGGAGAGGCAA
CAGTCTCCTTTGATGACCCACCGTCTGCGAAAGCAGCGATCGACTGGTTTGAT---AAAGAATTCTCGGGGAATCCTATCAAGGTCTCATTTGCTACTCG
GCGAGCAGACTTCAATCGGGGCGGTGGCAATGGTCGTGGAGGCCGAGGGCGAGGA---CCCATGGGCCGTGGGGGCTACGGAGGTGGTGGCAGTGGTGGC
GGTGGCCGAGGAGGATTCCCCAGTGGCGGCGGTGGCGGAGGAGGACAGCAGCGAGCCGGGGACTGGAAGTGTCCTAAT---ACGTGTGAGAACATGAACT
TCTCTTGGAGGAATGAATGCAACCAGTGTAAGGCCCCCAAGCCAGATGGCCCAGGAGGGGGACCAGGAGGCTCTCATATG---GGCAGCTACGGAGATGA
TCGGCGTGGCGGCAGAGGCGGCTATGATCGAGGCGGCTACCGAGGCCGAGGCGGGGACCGTGGGGGCTTCCGAGGGGGCCGGGGTGGTGGGGACAGAGGT
GGCTTTGGCCCTGGCAAGATGGACTCC---GGCGAGCACAGACAGGATCGAAGGGAGAGGCCGTAT---


>BGISUSP0000885434
-------------YGAYPTQPGQGYSQQSNQPYGQQSYSGYGQSADTSGYGQSSYGSSYGQTQ-GYGTQSAPQGYGSAGGYGGSQGSQSSYGQQSSYPGY
GQQPAPSSTSG-YGTSSQSSGYGQPQSGGYGQQSGYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGG---------------------------
----------QDRGGRGRGGGSGGGGGYNRSSGGYEPRGRGGGRGGRGGM-GSDRGGFNKFG-PRDQGSRHD-----------FVQGLGENVTIESVADY
FKQIGIIKTNKKTGQPMINLYTDWETGKLKGEATVSFDDPPSAKAAIDWFD-KEFSGNPIKVSFATRRADFNRGGGNGRGGRGRG-PMGRGGYGGGGSGG
GGRGGFPSGGGGGGGQQRAGDWKCPN-TCENMNFSWRNECNQCKAPKPDGPGGGPGGSHM-GSYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRG
GFGPGKMDS-GEHRQDRRERPY-