Sequences
EST Library Info
amn3Amnion
Clusters
Oligos
SNPs

Gene ID ENSG00000132518 (click for geneview)
Transcript ID ENST00000254854(link to ensembl)
Symbol GUCY2D
Localtion Chromosome:17:7846713:7864382:1 band: 17p13.1
Description Retinal guanylyl cyclase 1 precursor (EC 4.6.1.2) (Guanylate cyclase 2D, retinal) (RETGC-1) (Rod outer segment membrane guanylate cyclase) (ROS-GC). [Source:Uniprot/SWISSPROT;Acc:Q02846]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--A--C--A--R--R--A--G--G--L--P--D--P--G--L--C--G--P--A--W--W--A--P--S--L--P--R--L--P--R--A--L--
ATGACCGCCTGCGCCCGCCGAGCGGGTGGGCTTCCGGACCCCGGGCTCTGCGGTCCCGCGTGGTGGGCTCCGTCCCTGCCCCGCCTCCCCCGGGCCCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--R--L--P--L--L--L--L--L--L--L--L--Q--P--P--A--L--S--A--V--F--T--V--G--V--L--G--P--W--A--C--D--P--I
CCCGGCTCCCGCTCCTGCTGCTCCTGCTTCTGCTGCAGCCCCCCGCCCTCTCCGCCGTGTTCACGGTGGGGGTCCTGGGCCCCTGGGCTTGCGACCCCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--F--S--R--A--R--P--D--L--A--A--R--L--A--A--A--R--L--N--R--D--P--G--L--A--G--G--P--R--F--E--V--A--L-
CTTCTCTCGGGCTCGCCCGGACCTGGCCGCCCGCCTGGCCGCCGCCCGCCTGAACCGCGACCCCGGCCTGGCAGGCGGTCCCCGCTTCGAGGTAGCGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--P--E--P--C--R--T--P--G--S--L--G--A--V--S--S--A--L--A--R--V--S--G--L--V--G--P--V--N--P--A--A--C--
CTGCCCGAGCCTTGCCGGACGCCGGGCTCGCTGGGGGCCGTGTCCTCCGCGCTGGCCCGCGTGTCGGGCCTCGTGGGTCCGGTGAACCCTGCGGCCTGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--P--A--E--L--L--A--E--E--A--G--I--A--L--V--P--W--G--C--P--W--T--Q--A--E--G--T--T--A--P--A--V--T--P
GGCCAGCCGAGCTGCTCGCCGAAGAAGCCGGGATCGCGCTGGTGCCCTGGGGCTGCCCCTGGACGCAGGCGGAGGGCACCACGGCCCCTGCCGTGACCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--A--D--A--L--Y--A--L--L--R--A--F--G--W--A--R--V--A--L--V--T--A--P--Q--D--L--W--V--E--A--G--R--S-
CGCCGCGGATGCCCTCTACGCCCTGCTTCGCGCATTCGGCTGGGCGCGCGTGGCCCTGGTCACCGCCCCCCAGGACCTGTGGGTGGAGGCGGGACGCTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--S--T--A--L--R--A--R--G--L--P--V--A--S--V--T--S--M--E--P--L--D--L--S--G--A--R--E--A--L--R--K--V--
CTGTCCACGGCACTCAGGGCCCGGGGCCTGCCTGTCGCCTCCGTGACTTCCATGGAGCCCTTGGACCTGTCTGGAGCCCGGGAGGCCCTGAGGAAGGTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------><------------------------------------------------------------------------------
R--D--G--P--R--V--T--A--V--I--M--V--M--H--S--V--L--L--G--G--E--E--Q--R--Y--L--L--E--A--A--E--E--L--G
GGGACGGGCCCAGGGTCACAGCAGTGATCATGGTGATGCACTCGGTGCTGCTGGGTGGCGAGGAGCAGCGCTACCTCCTGGAGGCCGCAGAGGAGCTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--T--D--G--S--L--V--F--L--P--F--D--T--I--H--Y--A--L--S--P--G--P--E--A--L--A--A--L--A--N--S--S--Q-
CCTGACCGATGGCTCCCTGGTCTTCCTGCCCTTCGACACGATCCACTACGCCTTGTCCCCAGGCCCGGAGGCCTTGGCCGCACTCGCCAACAGCTCCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--R--R--A--H--D--A--V--L--T--L--T--R--H--C--P--S--E--G--S--V--L--D--S--L--R--R--A--Q--E--R--R--E--
CTTCGCAGGGCCCACGATGCCGTGCTCACCCTCACGCGCCACTGTCCCTCTGAAGGCAGCGTGCTGGACAGCCTGCGCAGGGCTCAAGAGCGCCGCGAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------><-------------------------------------------------------------------------
L--P--S--D--L--N--L--Q--Q--V--S--P--L--F--G--T--I--Y--D--A--V--F--L--L--A--R--G--V--A--E--A--R--A--A
TGCCCTCTGACCTCAATCTGCAGCAGGTCTCCCCACTCTTTGGCACCATCTATGACGCGGTCTTCTTGCTGGCAAGGGGCGTGGCAGAAGCGCGGGCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--G--G--R--W--V--S--G--A--A--V--A--R--H--I--R--D--A--Q--V--P--G--F--C--G--D--L--G--G--D--E--E--P-
CGCAGGTGGCAGATGGGTGTCCGGAGCAGCTGTGGCCCGCCACATCCGGGATGCGCAGGTCCCTGGCTTCTGCGGGGACCTAGGAGGAGACGAGGAGCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--F--V--L--L--D--T--D--A--A--G--D--R--L--F--A--T--Y--M--L--D--P--A--R--G--S--F--L--S--A--G--T--R--
CCATTCGTGCTGCTAGACACGGACGCGGCGGGAGACCGGCTTTTTGCCACATACATGCTGGATCCTGCCCGGGGCTCCTTCCTCTCCGCCGGTACCCGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------><---------------------
M--H--F--P--R--G--G--S--A--P--G--P--D--P--S--C--W--F--D--P--N--N--I--C--G--G--G--L--E--P--G--L--V--F
TGCACTTCCCGCGTGGGGGATCAGCACCCGGACCTGACCCCTCGTGCTGGTTCGATCCAAACAACATCTGCGGTGGAGGACTGGAGCCGGGCCTCGTCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------><------------------------------------
--L--G--F--L--L--V--V--G--M--G--L--A--G--A--F--L--A--H--Y--V--R--H--R--L--L--H--M--Q--M--V--S--G--P-
TCTTGGCTTCCTCCTGGTGGTTGGGATGGGGCTGGCTGGGGCCTTCCTGGCCCATTATGTGAGGCACCGGCTACTTCACATGCAAATGGTCTCCGGCCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------><---------------------------------
-N--K--I--I--L--T--V--D--D--I--T--F--L--H--P--H--G--G--T--S--R--K--V--A--Q--G--S--R--S--S--L--G--A--
AACAAGATCATCCTGACCGTGGACGACATCACCTTTCTCCACCCACATGGGGGCACCTCTCGAAAGGTGGCCCAGGGGAGTCGATCAAGTCTGGGTGCCC
                                                                  ::.:::::::: :::::: :::::::::  : ::
------------------------------------------------------------------GTAGCCCAGGGCAGTCGAACAAGTCTGGCGGGCC
-------------------------------------------------------------------V--A--Q--G--S--R--T--S--L--A--G--

-------------------------------------------------------------------><-------------------------------
R--S--M--S--D--I--R--S--G--P--S--Q--H--L--D--S--P--N--I--G--V--Y--E--G--D--R--V--W--L--K--K--F--P--G
GCAGCATGTCAGACATTCGCAGCGGCCCCAGCCAACACTTGGACAGCCCCAACATTGGTGTCTATGAGGGAGACAGGGTTTGGCTGAAGAAATTCCCAGG
::::::::::::::.::::::::  :: ::::::..::..:::.::: :::::::.::. ::::.:::                                
GCAGCATGTCAGACGTTCGCAGCCTCCACAGCCAGTACCCGGATAGCACCAACATCGGCCTCTACGAG--------------------------------
R--S--M--S--D--V--R--S--L--H--S--Q--Y--P--D--S--T--N--I--G--L--Y--E---------------------------------

------------------------------------------------><--------------------------------------------------
--D--Q--H--I--A--I--R--P--A--T--K--T--A--F--S--K--L--Q--E--L--R--H--E--N--V--A--L--Y--L--G--L--F--L-
GGATCAGCACATAGCTATCCGCCCAGCAACCAAGACGGCCTTCTCCAAGCTCCAGGAGCTCCGGCATGAGAACGTGGCCCTCTACCTGGGGCTTTTCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--R--G--A--E--G--P--A--A--L--W--E--G--N--L--A--V--V--S--E--H--C--T--R--G--S--L--Q--D--L--L--A--Q--
GCTCGGGGAGCAGAAGGCCCTGCGGCCCTCTGGGAGGGCAACCTGGCTGTGGTCTCAGAGCACTGCACGCGGGGCTCTCTTCAGGACCTCCTCGCTCAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------><-------------------------------------------
R--E--I--K--L--D--W--M--F--K--S--S--L--L--L--D--L--I--K--G--I--R--Y--L--H--H--R--G--V--A--H--G--R--L
GAGAAATAAAGCTGGACTGGATGTTCAAGTCCTCCCTCCTGCTGGACCTTATCAAGGGAATAAGGTATCTGCACCATCGAGGCGTGGCTCATGGGCGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--S--R--N--C--I--V--D--G--R--F--V--L--K--I--T--D--H--G--H--G--R--L--L--E--A--Q--K--V--L--P--E--P-
GAAGTCACGGAACTGCATAGTGGATGGCAGATTCGTACTCAAGATCACTGACCACGGCCACGGGAGACTGCTGGAAGCACAGAAGGTGCTACCGGAGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><--------------------------------------------------------------------------------------
-P--R--A--E--D--Q--L--W--T--A--P--E--L--L--R--D--P--A--L--E--R--R--G--T--L--A--G--D--V--F--S--L--A--
CCCAGAGCGGAGGACCAGCTGTGGACAGCCCCGGAGCTGCTTAGGGACCCAGCCCTGGAGCGCCGGGGAACGCTGGCCGGCGACGTCTTTAGCTTGGCCA
               :::::.:::::::::::.::::::::: ::::::: ::::::::::: ::::::::.::.:::::.::::: ::.:::.::. ::
---------------CAGCTATGGACAGCCCCAGAGCTGCTTCGGGACCCTGCCCTGGAGCGGCGGGGAACACTAGCCGGTGACGTGTTCAGCCTGAGCA
----------------Q--L--W--T--A--P--E--L--L--R--D--P--A--L--E--R--R--G--T--L--A--G--D--V--F--S--L--S--

--------------------------------------------------------------><------------------------------------
I--I--M--Q--E--V--V--C--R--S--A--P--Y--A--M--L--E--L--T--P--E--E--V--V--Q--R--V--R--S--P--P--P--L--C
TCATCATGCAAGAAGTAGTGTGCCGCAGTGCCCCTTATGCCATGCTGGAGCTCACTCCCGAGGAAGTGGTGCAGAGGGTGCGGAGCCCCCCTCCACTGTG
::::::::::.::.::.:::::::::::. ::::.::.::::::::::::::  : ::.:::                                      
TCATCATGCAGGAGGTGGTGTGCCGCAGCCCCCCCTACGCCATGCTGGAGCTGCCGCCTGAG--------------------------------------
I--I--M--Q--E--V--V--C--R--S--P--P--Y--A--M--L--E--L--P--P--E---------------------------------------

----------------------------------------------------------------------------------------------------
--R--P--L--V--S--M--D--Q--A--P--V--E--C--I--L--L--M--K--Q--C--W--A--E--Q--P--E--L--R--P--S--M--D--H-
TCGGCCCTTGGTGTCCATGGACCAGGCACCTGTCGAGTGTATCCTCCTGATGAAGCAGTGCTGGGCAGAGCAGCCGGAACTTCGGCCCTCCATGGACCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------><---------------------------------------------------------------------------------------
-T--F--D--L--F--K--N--I--N--K--G--R--K--T--N--I--I--D--S--M--L--R--M--L--E--Q--Y--S--S--N--L--E-----
ACCTTCGACCTGTTCAAGAACATCAACAAGGGCCGGAAGACGAACATCATTGACTCGATGCTTCGGATGCTGGAGCAGTACTCTAGTAACCTGGAG---G
                  :.::::::::::::::::::::.::::::.::.::::::::::: ::::::::::::::::::::.::.:::::::::   :
------------------AGCATCAACAAGGGCCGGAAGATGAACATTATCGACTCGATGCTGCGGATGCTGGAGCAGTACTCCAGCAACCTGGAGT--G
-------------------S--I--N--K--G--R--K--M--N--I--I--D--S--M--L--R--M--L--E--Q--Y--S--S--N--L--E--\--

------------------------------------------------------------------------------><--------------------
D--L--I--R--E--R--T--E--E--L--E--L--E--K--Q--K--T--D--R--L--L--T--Q--M--L--P--P--S--V--A--E--A--L--K
ATCTGATCCGGGAGCGCACGGAGGAGCTGGAGCTGGAAAAGCAGAAGACAGACCGGCTGCTTACACAGATGCTGCCTCCGTCTGTGGCTGAGGCCTTGAA
:.:::::: ::::::::::.:::::::::::::::::::::::::::::::::::::::::.:::::::::::::::   :::::::: :::::..::::
ACCTGATCGGGGAGCGCACAGAGGAGCTGGAGCTGGAAAAGCAGAAGACAGACCGGCTGCTCACACAGATGCTGCCT---TCTGTGGCAGAGGCTCTGAA
D--L--I--G--E--R--T--E--E--L--E--L--E--K--Q--K--T--D--R--L--L--T--Q--M--L--P-----S--V--A--E--A--L--K

----------------------------------------------------------------------------------------------------
--T--G--T--P--V--E--P--E--Y--F--E--Q--V--T--L--Y--F--S--D--I--V--G--F--T--T--I--S--A--M--S--E--P--I-
GACGGGGACACCAGTGGAGCCCGAGTACTTTGAGCAAGTGACACTGTACTTTAGTGACATTGTGGGCTTCACCACCATCTCTGCCATGAGTGAGCCCATT
::.:::::: :: ::::::::.:::::.::.::: :.::::::::::::::.::::::::::::::.:::::::::::::: :::::::::::::::::.
GATGGGGACCCCTGTGGAGCCTGAGTATTTCGAGGAGGTGACACTGTACTTCAGTGACATTGTGGGTTTCACCACCATCTCAGCCATGAGTGAGCCCATC
--M--G--T--P--V--E--P--E--Y--F--E--E--V--T--L--Y--F--S--D--I--V--G--F--T--T--I--S--A--M--S--E--P--I-

-----------------------------------------------------------------------><---------------------------
-E--V--V--D--L--L--N--D--L--Y--T--L--F--D--A--I--I--G--S--H--D--V--Y--K--V--E--T--I--G--D--A--Y--M--
GAGGTTGTGGACCTGCTCAACGATCTCTACACACTCTTTGATGCCATCATTGGTTCCCACGATGTCTACAAGGTGGAGACAATAGGGGACGCCTATATGG
::.::.::::::::.::::::::.::::::::.::.::.:::::::::::.::.:::::.::::::::::::::::::::.:: :::::::::::.::::
GAAGTCGTGGACCTACTCAACGACCTCTACACGCTTTTCGATGCCATCATCGGCTCCCATGATGTCTACAAGGTGGAGACGATTGGGGACGCCTACATGG
-E--V--V--D--L--L--N--D--L--Y--T--L--F--D--A--I--I--G--S--H--D--V--Y--K--V--E--T--I--G--D--A--Y--M--

----------------------------------------------------------------------------------------------------
V--A--S--G--L--P--Q--R--N--G--Q--R--H--A--A--E--I--A--N--M--S--L--D--I--L--S--A--V--G--T--F--R--M--R
TGGCCTCGGGGCTGCCCCAGCGGAATGGGCAGCGACACGCGGCAGAGATCGCCAACATGTCACTGGACATCCTCAGTGCCGTGGGCACTTTCCGCATGCG
:::::::.:::::::::::::: ::.::::::::.::::::::.::::::::::::::: : ::::::::::::::.::::::::: :.:::::::::::
TGGCCTCAGGGCTGCCCCAGCGCAACGGGCAGCGGCACGCGGCGGAGATCGCCAACATGGCCCTGGACATCCTCAGCGCCGTGGGCTCCTTCCGCATGCG
V--A--S--G--L--P--Q--R--N--G--Q--R--H--A--A--E--I--A--N--M--A--L--D--I--L--S--A--V--G--S--F--R--M--R

----------------------------------------------><----------------------------------------------------
--H--M--P--E--V--P--V--R--I--R--I--G--L--H--S--G--P--C--V--A--G--V--V--G--L--T--M--P--R--Y--C--L--F-
CCATATGCCTGAGGTTCCCGTGCGCATCCGCATAGGCCTGCACTCGGGTCCATGCGTGGCAGGCGTGGTGGGCCTCACCATGCCGCGGTACTGCCTGTTT
:::.:::::.::::: ::::::::::::::::: ::::::::::::   ::.::::::::.::::::::::::::::::::::::::::::::::::::.
CCACATGCCCGAGGTGCCCGTGCGCATCCGCATCGGCCTGCACTCG---CCGTGCGTGGCGGGCGTGGTGGGCCTCACCATGCCGCGGTACTGCCTGTTC
--H--M--P--E--V--P--V--R--I--R--I--G--L--H--S-----P--C--V--A--G--V--V--G--L--T--M--P--R--Y--C--L--F-

---------------------------------------------><-----------------------------------------------------
-G--D--T--V--N--T--A--S--R--M--E--S--T--G--L--P--Y--R--I--H--V--N--L--S--T--V--G--I--L--R--A--L--D--
GGGGACACGGTCAACACCGCCTCGCGCATGGAGTCCACCGGGCTGCCTTACCGCATCCACGTGAACTTGAGCACTGTGGGGATTCTCCGTGCTCTGGACT
::::::::::::::::: :::::::::::::::::::: ::::::   :::::::::::::::::: :::::::.::: ::::.:::.:.::.::.:::.
GGGGACACGGTCAACACGGCCTCGCGCATGGAGTCCACAGGGCTG---TACCGCATCCACGTGAACATGAGCACCGTGCGGATCCTCTGCGCCCTAGACC
-G--D--T--V--N--T--A--S--R--M--E--S--T--G--L-----Y--R--I--H--V--N--M--S--T--V--R--I--L--C--A--L--D--

----------------------------------------><----------------------------------------------------------
S--G--Y--Q--V--E--L--R--G--R--T--E--L--K--G--K--G--A--E--D--T--F--W--L--V--G--R--R--G--F--N--K--P--I
CGGGCTACCAGGTGGAGCTGCGAGGCCGCACGGAGCTGAAGGGCAAGGGCGCCGAGGACACTTTCTGGCTAGTGGGCAGACGCGGCTTCAACAAGCCCAT
 ::::: ::::..:::: ::::.:::::::: ::::::::::::::::::::::::::::: : ::::::.:::::::::::::::::::::::::::::
AGGGCTTCCAGACGGAGGTGCGGGGCCGCACCGAGCTGAAGGGCAAGGGCGCCGAGGACACGTACTGGCTGGTGGGCAGACGCGGCTTCAACAAGCCCAT
Q--G--F--Q--T--E--V--R--G--R--T--E--L--K--G--K--G--A--E--D--T--Y--W--L--V--G--R--R--G--F--N--K--P--I

--------------------------><------------------------------------------------------------------------
--P--K--P--P--D--L--Q--P--G--S--S--N--H--G--I--S--L--Q--E--I--P--P--E--R--R--R--K--L--E--K--A--R--P-
CCCCAAACCGCCTGACCTGCAACCGGGGTCCAGCAACCACGGCATCAGCCTGCAGGAGATCCCACCCGAGCGGCGACGGAAGCTGGAGAAGGCGCGGCCG
:::::::::::::::::::::::::    :::::::::::::::::::::::::::::::.:: ::::::::::: :.:                     
CCCCAAACCGCCTGACCTGCAACCG---GCCAGCAACCACGGCATCAGCCTGCAGGAGATTCCCCCCGAGCGGCGCCAG---------------------
--P--K--P--P--D--L--Q--P-----A--S--N--H--G--I--S--L--Q--E--I--P--P--E--R--R--Q----------------------

-------------->
-G--Q--F--S--*-
GGCCAGTTCTCTTGA
               
---------------
---------------

Pig Consensus Sequence

>BGISUST0000899831
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------GTAGCCCAGGGCAGTCGAACAAGTCTGGCGGGCC
GCAGCATGTCAGACGTTCGCAGCCTCCACAGCCAGTACCCGGATAGCACCAACATCGGCCTCTACGAG--------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------CAGCTATGGACAGCCCCAGAGCTGCTTCGGGACCCTGCCCTGGAGCGGCGGGGAACACTAGCCGGTGACGTGTTCAGCCTGAGCA
TCATCATGCAGGAGGTGGTGTGCCGCAGCCCCCCCTACGCCATGCTGGAGCTGCCGCCTGAG--------------------------------------
----------------------------------------------------------------------------------------------------
------------------AGCATCAACAAGGGCCGGAAGATGAACATTATCGACTCGATGCTGCGGATGCTGGAGCAGTACTCCAGCAACCTGGAggACC
TGATCGGGGAGCGCACAGAGGAGCTGGAGCTGGAAAAGCAGAAGACAGACCGGCTGCTCACACAGATGCTGCCT---TCTGTGGCAGAGGCTCTGAAGAT
GGGGACCCCTGTGGAGCCTGAGTATTTCGAGGAGGTGACACTGTACTTCAGTGACATTGTGGGTTTCACCACCATCTCAGCCATGAGTGAGCCCATCGAA
GTCGTGGACCTACTCAACGACCTCTACACGCTTTTCGATGCCATCATCGGCTCCCATGATGTCTACAAGGTGGAGACGATTGGGGACGCCTACATGGTGG
CCTCAGGGCTGCCCCAGCGCAACGGGCAGCGGCACGCGGCGGAGATCGCCAACATGGCCCTGGACATCCTCAGCGCCGTGGGCTCCTTCCGCATGCGCCA
CATGCCCGAGGTGCCCGTGCGCATCCGCATCGGCCTGCACTCG---CCGTGCGTGGCGGGCGTGGTGGGCCTCACCATGCCGCGGTACTGCCTGTTCGGG
GACACGGTCAACACGGCCTCGCGCATGGAGTCCACAGGGCTG---TACCGCATCCACGTGAACATGAGCACCGTGCGGATCCTCTGCGCCCTAGACCAGG
GCTTCCAGACGGAGGTGCGGGGCCGCACCGAGCTGAAGGGCAAGGGCGCCGAGGACACGTACTGGCTGGTGGGCAGACGCGGCTTCAACAAGCCCATCCC
CAAACCGCCTGACCTGCAACCG---GCCAGCAACCACGGCATCAGCCTGCAGGAGATTCCCCCCGAGCGGCGCCAG------------------------
------------


>BGISUSP0000899831
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------VAQGSRTSLAGRSMSDVRSLHSQYPDSTNIGLYE--------------------------------------------
----------------------------------------------------------------------------------------------------
-----QLWTAPELLRDPALERRGTLAGDVFSLSIIMQEVVCRSPPYAMLELPPE----------------------------------------------
------SINKGRKMNIIDSMLRMLEQYSSNLEDLIGERTEELELEKQKTDRLLTQMLP-SVAEALKMGTPVEPEYFEEVTLYFSDIVGFTTISAMSEPIE
VVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMALDILSAVGSFRMRHMPEVPVRIRIGLHS-PCVAGVVGLTMPRYCLFG
DTVNTASRMESTGL-YRIHVNMSTVRILCALDQGFQTEVRGRTELKGKGAEDTYWLVGRRGFNKPIPKPPDLQP-ASNHGISLQEIPPERRQ--------
----