Sequences
EST Library Info
nep1Newborn 115 days, epidermis
plac2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000132938 (click for geneview)
Transcript ID ENST00000255289(link to ensembl)
Symbol KIAA0774
Localtion Chromosome:13:28497451:28975872:1 band: 13q12.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-R--G--Q--I--P--G--G--G--E--G--P--Q--K--T--L--P--D--H--A--V--P--A--A--F--P--A--T--D--S--T--S--E--G--
CGGGGTCAGATACCTGGGGGTGGGGAGGGGCCACAGAAGACATTGCCAGACCACGCTGTCCCGGCAGCTTTCCCTGCAACTGACAGTACCTCAGAGGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--S--V--R--H--P--K--P--S--T--S--E--S--K--Q--S--T--P--S--E--T--Q--T--V--G--A--H--V--L--Q--V--C--S--E
AGAGTGTGCGTCATCCTAAACCATCTACCTCAGAAAGCAAGCAGAGCACTCCCTCAGAGACCCAAACAGTGGGGGCACATGTACTGCAGGTGTGCAGTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--H--T--S--H--S--A--H--P--E--P--A--L--N--L--T--L--A--S--K--E--I--P--S--K--L--E--A--Q--L--G--Q--G--K-
GCACACATCACATTCCGCCCATCCAGAGCCTGCTCTGAATTTGACTTTGGCATCGAAGGAAATCCCAAGTAAACTGGAAGCACAATTAGGTCAGGGAAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--E--A--K--L--D--L--K--Y--V--P--P--R--R--V--E--Q--E--G--K--A--A--Q--E--G--Y--L--G--C--H--K--E--E--
GGAGAGGCCAAGCTGGATCTGAAATATGTTCCTCCCAGGAGAGTTGAACAGGAGGGAAAGGCAGCCCAGGAAGGGTATCTGGGATGCCACAAGGAAGAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--L--S--A--L--E--G--R--D--P--C--G--E--A--H--P--E--A--T--D--A--L--G--H--L--L--N--S--D--L--H--H--L--G
ATCTGTCAGCCTTGGAGGGAAGGGATCCATGTGGGGAAGCACACCCGGAAGCCACCGATGCACTTGGCCATCTGCTGAACAGTGACCTCCACCACCTTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--G--R--G--N--C--E--E--K--R--G--V--N--P--G--E--Q--D--S--L--H--T--T--P--K--Q--G--S--A--S--L--G--G-
GGTGGGAAGAGGCAACTGTGAAGAGAAGAGAGGAGTCAACCCAGGGGAGCAGGATTCTCTCCACACCACCCCCAAACAGGGCTCTGCTTCCTTAGGAGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--D--N--Q--P--T--G--K--I--S--P--C--A--G--E--K--L--G--E--R--T--S--S--S--F--S--P--G--D--S--H--V--A--
GCTGATAATCAGCCCACTGGCAAAATTTCACCATGTGCAGGTGAGAAGTTGGGTGAAAGGACATCCAGCAGCTTTTCACCAGGTGACAGTCATGTGGCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--I--P--N--N--L--T--D--S--K--P--L--D--V--I--E--E--E--R--R--L--G--S--G--N--K--D--S--V--M--V--L--V--F
TTATTCCTAATAATCTGACTGACAGCAAGCCCTTGGATGTCATTGAGGAGGAAAGGCGGTTGGGCAGTGGGAATAAGGACAGTGTTATGGTTTTGGTGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--P--S--V--G--E--N--K--T--E--V--P--E--P--L--D--P--Q--S--G--R--S--E--A--R--E--S--K--E--V--T--T--S-
CAATCCTTCTGTTGGAGAGAACAAGACGGAGGTGCCTGAGCCCCTGGACCCTCAAAGTGGCCGCTCAGAAGCACGGGAAAGCAAAGAGGTCACCACATCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--A--E--N--R--N--L--L--E--N--A--D--K--I--E--S--T--S--A--R--A--D--S--V--L--N--I--P--A--P--L--H--P--
GTTGCTGAAAACAGGAACCTTCTAGAGAATGCAGATAAGATTGAAAGCACCTCAGCAAGAGCAGATTCAGTTCTCAATATTCCAGCACCCCTCCACCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--T--T--V--N--M--T--Y--Q--P--T--T--P--S--S--S--F--Q--D--V--S--V--F--G--M--D--A--G--S--P--L--V--V--P
AGACAACTGTGAACATGACCTACCAGCCTACAACACCCAGTAGCAGTTTTCAGGATGTTAGCGTGTTCGGTATGGATGCGGGGTCCCCCTTGGTAGTTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--P--T--D--S--A--R--L--L--N--T--S--P--K--V--P--D--K--N--T--C--P--S--G--I--P--K--P--V--F--T--H--S-
ACCCCCTACTGATAGTGCACGCTTGTTGAACACGTCCCCCAAAGTGCCTGACAAGAACACTTGCCCCAGTGGGATCCCCAAGCCTGTCTTCACACATTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--D--T--P--S--S--Q--E--G--M--E--N--Y--Q--V--E--K--T--E--E--R--T--E--T--K--P--I--I--M--P--K--P--K--
AAGGACACACCTTCCTCGCAGGAGGGAATGGAGAACTATCAGGTTGAAAAAACAGAGGAGAGGACAGAAACTAAGCCCATCATTATGCCCAAGCCCAAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--V--R--P--K--I--I--T--Y--I--R--R--N--P--Q--A--L--G--Q--V--D--A--S--L--V--P--V--G--L--P--Y--A--P--P
ATGTGAGGCCCAAGATCATCACCTACATCAGGAGGAATCCCCAGGCCCTGGGCCAGGTGGACGCCTCGCTGGTTCCAGTGGGGCTTCCATATGCCCCGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--C--T--M--P--L--P--H--E--E--K--A--A--G--G--D--L--K--P--S--A--N--L--Y--E--K--F--K--P--D--L--Q--K-
CACATGTACCATGCCTCTTCCCCACGAAGAGAAGGCAGCAGGTGGTGACCTGAAGCCATCTGCCAACCTCTATGAGAAATTCAAGCCAGACCTGCAGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------------><---------
-P--R--V--F--S--S--G--L--M--V--S--G--I--K--P--P--G--H--P--F--S--Q--M--S--E--K--F--L--Q--E--V--T--D--
CCAAGGGTCTTCAGTTCCGGATTGATGGTGTCTGGAATCAAGCCCCCGGGACATCCTTTCAGTCAAATGAGTGAAAAGTTTTTGCAGGAGGTTACAGACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--P--G--K--E--E--F--C--S--P--P--Y--A--H--Y--E--V--P--P--T--F--Y--R--S--A--M--L--L--K--P--Q--L--G--L
ACCCTGGAAAAGAAGAGTTTTGTTCTCCTCCCTATGCTCATTATGAAGTCCCTCCAACTTTCTATCGGTCAGCCATGCTCCTTAAGCCCCAGCTAGGATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--A--M--S--R--L--P--S--A--K--S--R--I--L--I--A--S--Q--R--S--S--A--S--A--I--H--P--P--G--P--I--T--T-
GGGTGCAATGTCCCGTTTACCATCTGCAAAGAGCAGGATTCTGATTGCAAGTCAGAGGTCTTCAGCGAGCGCCATCCACCCACCAGGACCCATAACAACA
                                                          ::::::: :::::::::::::::.:::::: :: ::.:.:: 
----------------------------------------------------------TCTTCAGGGAGCGCCATCCACCCGCCAGGAACCCTAGCGACC
-----------------------------------------------------------S--S--G--S--A--I--H--P--P--G--T--L--A--T-

------------------------------><--------------------------------------------------------------------
-A--T--S--L--Y--S--S--D--P--S--D--L--K--K--A--S--S--S--N--A--A--K--S--N--L--P--K--S--G--L--R--P--P--
GCCACCAGTCTCTACAGTTCCGATCCTTCAGATTTAAAGAAAGCTTCCAGTTCAAATGCTGCAAAATCCAATCTCCCGAAATCTGGTCTCCGTCCTCCCG
::..::. :::::::::::::::.::: ::   ::::::::.:: ::::::::::::::::::::.::::..:: ::.:::::::: :::::::::::.:
GCTGCCGCTCTCTACAGTTCCGACCCTGCA---TTAAAGAAGGCATCCAGTTCAAATGCTGCAAAGTCCAGCCTACCAAAATCTGGACTCCGTCCTCCTG
-A--A--A--L--Y--S--S--D--P--A-----L--K--K--A--S--S--S--N--A--A--K--S--S--L--P--K--S--G--L--R--P--P--

----------------------------------------------------------------------------------------------------
G--Y--S--R--L--P--A--A--K--L--A--A--F--G--F--V--R--S--S--S--V--S--S--V--S--S--T--Q--S--G--D--S--A--Q
GATACTCACGTCTCCCGGCAGCCAAACTGGCGGCATTTGGCTTTGTCCGGAGCTCCAGCGTCTCCTCAGTCTCCAGCACCCAGTCCGGGGACAGTGCACA
: :::::.::::::::.::::::::.::::::::.::::::::.:::::::::::::::::   :::.:: :::::::::::::: : ::::::.:: ::
GTTACTCGCGTCTCCCAGCAGCCAAGCTGGCGGCGTTTGGCTTCGTCCGGAGCTCCAGCGTGGGCTCGGTGTCCAGCACCCAGTCGGCGGACAGCGCCCA
G--Y--S--R--L--P--A--A--K--L--A--A--F--G--F--V--R--S--S--S--V--G--S--V--S--S--T--Q--S--A--D--S--A--Q

-------------------------><-------------------------------------------------------------------------
--P--E--Q--G--R--P--A--T--R--S--T--F--G--N--E--E--Q--P--V--L--K--A--S--L--P--S--K--D--T--P--K--G--A-
GCCAGAGCAGGGCCGGCCAGCCACCCGTTCAACCTTTGGGAATGAAGAACAGCCAGTTCTGAAGGCATCTCTGCCTTCTAAGGACACACCCAAGGGGGCC
::: ::::  ::::::            :::: :::::::: .:::::.:::::.:.:::::::::: ::::::::::.::.::: ::::::::::::::
GCCCGAGCCTGGCCGG------------TCAAACTTTGGGACCGAAGAGCAGCCGGCTCTGAAGGCAGCTCTGCCTTCCAAAGACCCACCCAAGGGGGCC
--P--E--P--G--R--------------S--N--F--G--T--E--E--Q--P--A--L--K--A--A--L--P--S--K--D--P--P--K--G--A-

---------------------------------------------------------------------------------------><-----------
-G--R--V--A--P--P--A--S--S--S--V--T--A--P--R--R--S--L--L--P--A--P--K--S--T--S--T--P--A--G--T--K--K--
GGCCGGGTGGCCCCTCCAGCATCCTCCAGTGTGACAGCACCCCGCAGGAGTTTACTTCCAGCGCCAAAATCCACTTCCACACCCGCTGGAACAAAGAAAG
.::::::. ::::: :: ::.::::::::::::::.::.:::::: :::::.:.:: ::.:::::::::::::: :::::::::      ::::::::::
AGCCGGGCCGCCCCGCCCGCGTCCTCCAGTGTGACGGCGCCCCGCCGGAGTCTGCTGCCGGCGCCAAAATCCACGTCCACACCC------ACAAAGAAAG
-S--R--A--A--P--P--A--S--S--S--V--T--A--P--R--R--S--L--L--P--A--P--K--S--T--S--T--P--------T--K--K--

--------------------------------------------------------------------------------------><------------
D--A--Q--K--D--Q--D--T--N--K--P--A--V--S--S--P--K--R--V--A--A--S--T--T--K--L--H--S--P--G--Y--P--K--Q
ATGCTCAGAAAGATCAAGATACGAATAAACCTGCTGTTTCATCTCCTAAGAGAGTAGCAGCTTCAACCACCAAGCTTCATTCACCAGGATACCCAAAGCA
: :: :::::::::::::::.: ::::::::::: ::::: ::::::::::::.::::::::::::::::::::::::::::.:::         :::::
AAGCACAGAAAGATCAAGATGCTAATAAACCTGCAGTTTCCTCTCCTAAGAGAATAGCAGCTTCAACCACCAAGCTTCATTCGCCA---------AAGCA
E--A--Q--K--D--Q--D--A--N--K--P--A--V--S--S--P--K--R--I--A--A--S--T--T--K--L--H--S--P-----------K--Q

----------------------------------------------------------------------------------------------------
--R--T--A--A--A--R--N--G--F--P--P--K--P--D--P--Q--A--R--E--A--E--R--Q--L--V--L--R--L--K--E--R--C--E-
GAGGACTGCGGCAGCTCGAAATGGGTTTCCGCCCAAGCCGGACCCGCAGGCCCGTGAGGCTGAGCGGCAGCTGGTGCTGCGGCTGAAGGAGCGGTGTGAG
::::::..::::  :.:: ::::: ::::: ::.:::::::::::::::::::: :::::.:::::::::::::::: ::::::.:.:            
GAGGACCACGGCCCCCCGCAATGGTTTTCCCCCTAAGCCGGACCCGCAGGCCCGGGAGGCCGAGCGGCAGCTGGTGCAGCGGCTAAGG------------
--R--T--T--A--P--R--N--G--F--P--P--K--P--D--P--Q--A--R--E--A--E--R--Q--L--V--Q--R--L--R-------------

--------------------------------------------------------------------------------------------------><
-Q--Q--T--R--Q--L--G--V--A--Q--G--E--L--K--R--A--I--C--G--F--D--A--L--A--V--A--T--Q--H--F--F--R--K--
CAGCAGACCAGACAGCTGGGCGTTGCGCAAGGGGAGCTGAAGAGGGCCATCTGCGGCTTTGATGCCCTCGCCGTGGCCACGCAGCATTTCTTTAGAAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------><---------------------------------
N--E--S--A--L--V--K--E--K--E--L--S--I--E--L--A--N--I--R--D--E--V--A--F--H--T--A--K--C--E--K--L--Q--K
ATGAAAGTGCCCTTGTGAAAGAAAAAGAGCTGTCAATCGAACTTGCAAACATCAGGGATGAAGTTGCCTTCCATACAGCAAAGTGCGAGAAACTACAAAA
  ::::::::::::: ::::::::::::::::::.:::::::::::.::::::::::::::::::   :::::.::.:: ::::::::: :.::.::.::
--GAAAGTGCCCTTGAGAAAGAAAAAGAGCTGTCGATCGAACTTGCGAACATCAGGGATGAAGTT---TTCCACACGGCCAAGTGCGAGCAGCTGCAGAA
---E--S--A--L--E--K--E--K--E--L--S--I--E--L--A--N--I--R--D--E--V-----F--H--T--A--K--C--E--Q--L--Q--K

----------------------------------------------------------------------------------------------------
--E--K--E--E--L--E--R--R--F--E--D--E--V--K--R--L--G--W--Q--Q--Q--A--E--L--Q--E--L--E--E--R--L--Q--L-
GGAGAAGGAGGAGCTGGAGAGGCGGTTCGAGGACGAGGTGAAGAGGCTGGGCTGGCAGCAGCAGGCCGAGCTCCAGGAGCTGGAGGAGCGGCTGCAGCTG
::::::::::::::::::: :::: : ::::::::::::: . :::::::::::::::::::.::::::::: :.:::::::::: ::::::::::::::
GGAGAAGGAGGAGCTGGAGCGGCGCTGCGAGGACGAGGTGCGCAGGCTGGGCTGGCAGCAGCGGGCCGAGCTGCGGGAGCTGGAGCAGCGGCTGCAGCTG
--E--K--E--E--L--E--R--R--C--E--D--E--V--R--R--L--G--W--Q--Q--R--A--E--L--R--E--L--E--Q--R--L--Q--L-

--------------------------------------------------------------------------------><------------------
-Q--F--E--A--E--M--A--R--L--Q--E--E--H--G--D--Q--L--L--S--I--R--C--Q--H--Q--E--Q--V--E--D--L--T--A--
CAATTCGAGGCGGAAATGGCGCGCCTGCAGGAGGAGCACGGTGACCAGCTGCTGAGCATCCGGTGTCAACACCAGGAGCAGGTGGAAGATCTCACCGCCA
::.::: :::::::.. ::: :: :: ::::: :::::. :.:  ::::::::: :  :: :::::::.:::::::::::::::::.::. :::::::::
CAGTTCCAGGCGGAGGGGGCCCGGCTCCAGGACGAGCATCGCGCGCAGCTGCTGCGGCTCGGGTGTCAGCACCAGGAGCAGGTGGAGGACATCACCGCCA
-Q--F--Q--A--E--G--A--R--L--Q--D--E--H--R--A--Q--L--L--R--L--G--C--Q--H--Q--E--Q--V--E--D--I--T--A--

--------------------------------------------------------------------------------------><------------
S--H--D--A--A--L--L--E--M--E--N--N--H--T--V--A--I--T--I--L--Q--D--D--H--D--H--K--V--Q--E--L--M--S--T
GCCATGATGCTGCTCTCCTAGAGATGGAAAATAACCACACAGTTGCCATCACAATCCTGCAGGATGACCACGACCACAAAGTCCAAGAATTGATGTCCAC
::::.:: :::::::::::::::::::::::.:.::::::.:::::::::.:.::::::::::::::::::::::::::.::::::   :::::.::.::
GCCACGAGGCTGCTCTCCTAGAGATGGAAAACAGCCACACGGTTGCCATCGCGATCCTGCAGGATGACCACGACCACAAGGTCCAA---TTGATATCTAC
S--H--E--A--A--L--L--E--M--E--N--S--H--T--V--A--I--A--I--L--Q--D--D--H--D--H--K--V--Q-----L--I--S--T

------------------------------------------------------------><--------------------------------------
--H--E--L--E--K--K--E--L--E--E--N--F--E--K--L--R--L--S--L--Q--D--Q--V--D--T--L--T--F--Q--S--Q--S--L-
TCATGAGCTTGAAAAGAAAGAATTGGAAGAAAATTTTGAAAAACTGCGGCTGTCATTGCAGGACCAGGTGGACACGCTGACCTTCCAGAGCCAGTCTCTG
.::.::::::::::::::::::::::::::.:::::::::::.::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::
CCACGAGCTTGAAAAGAAAGAATTGGAAGAGAATTTTGAAAAGCTGCGGCTGTCATTACAGGACCAGGTGGACACACTGACCTTCCAGAGCCAGTCTCTG
--H--E--L--E--K--K--E--L--E--E--N--F--E--K--L--R--L--S--L--Q--D--Q--V--D--T--L--T--F--Q--S--Q--S--L-

-----------------------------------------------------------><---------------------------------------
-R--D--R--A--R--R--F--E--E--A--L--R--K--N--T--E--E--Q--L--E--I--A--L--A--P--Y--Q--H--L--E--E--D--M--
CGGGACAGAGCCCGCCGCTTCGAAGAGGCCTTGAGGAAGAACACAGAGGAGCAGCTGGAGATTGCATTGGCTCCTTATCAGCACTTGGAAGAAGACATGA
:::::: ::::: : :::::.::.:::::::::::::.:::::: ::.::::::::::::::.::..:::::::::::::::::::::::::::::::::
CGGGACCGAGCCAGACGCTTTGAGGAGGCCTTGAGGAGGAACACTGAAGAGCAGCTGGAGATCGCGCTGGCTCCTTATCAGCACTTGGAAGAAGACATGA
-R--D--R--A--R--R--F--E--E--A--L--R--R--N--T--E--E--Q--L--E--I--A--L--A--P--Y--Q--H--L--E--E--D--M--

-------------------------------------------------------------------------------><-------------------
K--S--L--K--Q--V--L--E--M--K--N--Q--Q--I--H--E--Q--E--K--K--I--L--E--L--E--K--L--A--E--K--N--I--I--L
AGAGTCTGAAGCAGGTATTAGAAATGAAGAATCAGCAAATACACGAGCAAGAAAAGAAGATTCTTGAGCTGGAAAAGCTGGCAGAAAAGAACATTATCCT
::::.::::.:::::::::::::::::::::::::::::: ::: ::::.:::::::::::: : ::::::::::::::::::::.::::::::::::::
AGAGCCTGAGGCAGGTATTAGAAATGAAGAATCAGCAAATTCACCAGCAGGAAAAGAAGATTATGGAGCTGGAAAAGCTGGCAGAGAAGAACATTATCCT
K--S--L--R--Q--V--L--E--M--K--N--Q--Q--I--H--Q--Q--E--K--K--I--M--E--L--E--K--L--A--E--K--N--I--I--L

-----------------------------------------------------------------------------><---------------------
--E--E--K--I--Q--V--L--Q--Q--Q--N--E--D--L--K--A--R--I--D--Q--N--T--V--V--T--R--Q--L--S--E--E--N--A-
AGAAGAAAAGATCCAGGTTCTCCAACAGCAGAACGAAGACCTCAAAGCAAGGATTGACCAAAACACAGTTGTCACCAGACAGCTGTCGGAGGAAAATGCT
.:::::::::::::::::::::::.::::::::.:::::::::::::: :::::.:::::.::::: ::::::      :::::::::::::::::.:::
GGAAGAAAAGATCCAGGTTCTCCAGCAGCAGAATGAAGACCTCAAAGCCAGGATCGACCAGAACACCGTTGTC------CAGCTGTCGGAGGAAAACGCT
--E--E--K--I--Q--V--L--Q--Q--Q--N--E--D--L--K--A--R--I--D--Q--N--T--V--V--------Q--L--S--E--E--N--A-

----------------------------------------------------------------------------------------------------
-N--L--Q--E--Y--V--E--K--E--T--Q--E--K--K--R--L--S--R--T--N--E--E--L--L--W--K--L--Q--T--G--D--P--T--
AACCTCCAGGAATATGTTGAGAAGGAAACCCAGGAGAAGAAGAGATTGAGCCGAACCAATGAAGAGCTGCTTTGGAAGCTCCAAACTGGGGACCCGACCA
::.:: ::::::::.:: :::::.::::: ::.::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::
AATCTGCAGGAATACGTGGAGAAAGAAACGCAAGAGAAGAAGAGATTGAGCCGAACCAACGAAGAGCTGCTTTGGAAGCTCCAAACCGGGGACCCGACCA
-N--L--Q--E--Y--V--E--K--E--T--Q--E--K--K--R--L--S--R--T--N--E--E--L--L--W--K--L--Q--T--G--D--P--T--

------------------------------------------------------------------------------------------->
S--P--I--K--L--S--P--T--S--P--V--Y--R--G--S--S--S--G--P--S--S--P--A--R--V--S--T--T--P--R--*-
GTCCGATTAAACTCTCGCCCACATCTCCCGTTTACCGCGGCTCCTCCTCGGGGCCCTCCTCTCCGGCCAGAGTCAGCACAACACCCAGATGA
:.:::.::::::: :: :::::.::.::..::::::::::::::::::: :::::::::::::: :::::::::::::..::.:: ::::::
GCCCGGTTAAACTGTCCCCCACGTCCCCTATTTACCGCGGCTCCTCCTCCGGGCCCTCCTCTCCCGCCAGAGTCAGCATGACGCCAAGATGA
S--P--V--K--L--S--P--T--S--P--I--Y--R--G--S--S--S--G--P--S--S--P--A--R--V--S--M--T--P--R--*-

Pig Consensus Sequence

>BGISUST0000889870
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------TCTTCAGGGAGCGCCATCCACCCGCCAGGAACCCTAGCGACC
GCTGCCGCTCTCTACAGTTCCGACCCTGCA---TTAAAGAAGGCATCCAGTTCAAATGCTGCAAAGTCCAGCCTACCAAAATCTGGACTCCGTCCTCCTG
GTTACTCGCGTCTCCCAGCAGCCAAGCTGGCGGCGTTTGGCTTCGTCCGGAGCTCCAGCGTGGGCTCGGTGTCCAGCACCCAGTCGGCGGACAGCGCCCA
GCCCGAGCCTGGCCGG------------TCAAACTTTGGGACCGAAGAGCAGCCGGCTCTGAAGGCAGCTCTGCCTTCCAAAGACCCACCCAAGGGGGCC
AGCCGGGCCGCCCCGCCCGCGTCCTCCAGTGTGACGGCGCCCCGCCGGAGTCTGCTGCCGGCGCCAAAATCCACGTCCACACCC------ACAAAGAAAG
AAGCACAGAAAGATCAAGATGCTAATAAACCTGCAGTTTCCTCTCCTAAGAGAATAGCAGCTTCAACCACCAAGCTTCATTCGCCA---------AAGCA
GAGGACCACGGCCCCCCGCAATGGTTTTCCCCCTAAGCCGGACCCGCAGGCCCGGGAGGCCGAGCGGCAGCTGGTGCAGCGGCTAAGG------------
----------------------------------------------------------------------------------------------------
--GAAAGTGCCCTTGAGAAAGAAAAAGAGCTGTCGATCGAACTTGCGAACATCAGGGATGAAGTT---TTCCACACGGCCAAGTGCGAGCAGCTGCAGAA
GGAGAAGGAGGAGCTGGAGCGGCGCTGCGAGGACGAGGTGCGCAGGCTGGGCTGGCAGCAGCGGGCCGAGCTGCGGGAGCTGGAGCAGCGGCTGCAGCTG
CAGTTCCAGGCGGAGGGGGCCCGGCTCCAGGACGAGCATCGCGCGCAGCTGCTGCGGCTCGGGTGTCAGCACCAGGAGCAGGTGGAGGACATCACCGCCA
GCCACGAGGCTGCTCTCCTAGAGATGGAAAACAGCCACACGGTTGCCATCGCGATCCTGCAGGATGACCACGACCACAAGGTCCAA---TTGATATCTAC
CCACGAGCTTGAAAAGAAAGAATTGGAAGAGAATTTTGAAAAGCTGCGGCTGTCATTACAGGACCAGGTGGACACACTGACCTTCCAGAGCCAGTCTCTG
CGGGACCGAGCCAGACGCTTTGAGGAGGCCTTGAGGAGGAACACTGAAGAGCAGCTGGAGATCGCGCTGGCTCCTTATCAGCACTTGGAAGAAGACATGA
AGAGCCTGAGGCAGGTATTAGAAATGAAGAATCAGCAAATTCACCAGCAGGAAAAGAAGATTATGGAGCTGGAAAAGCTGGCAGAGAAGAACATTATCCT
GGAAGAAAAGATCCAGGTTCTCCAGCAGCAGAATGAAGACCTCAAAGCCAGGATCGACCAGAACACCGTTGTC------CAGCTGTCGGAGGAAAACGCT
AATCTGCAGGAATACGTGGAGAAAGAAACGCAAGAGAAGAAGAGATTGAGCCGAACCAACGAAGAGCTGCTTTGGAAGCTCCAAACCGGGGACCCGACCA
GCCCGGTTAAACTGTCCCCCACGTCCCCTATTTACCGCGGCTCCTCCTCCGGGCCCTCCTCTCCCGCCAGAGTCAGCATGACGCCAAGATGA


>BGISUSP0000889870
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------SSGSAIHPPGTLAT
AAALYSSDPA-LKKASSSNAAKSSLPKSGLRPPGYSRLPAAKLAAFGFVRSSSVGSVSSTQSADSAQPEPGR----SNFGTEEQPALKAALPSKDPPKGA
SRAAPPASSSVTAPRRSLLPAPKSTSTP--TKKEAQKDQDANKPAVSSPKRIAASTTKLHSP---KQRTTAPRNGFPPKPDPQAREAERQLVQRLR----
----------------------------------ESALEKEKELSIELANIRDEV-FHTAKCEQLQKEKEELERRCEDEVRRLGWQQRAELRELEQRLQL
QFQAEGARLQDEHRAQLLRLGCQHQEQVEDITASHEAALLEMENSHTVAIAILQDDHDHKVQ-LISTHELEKKELEENFEKLRLSLQDQVDTLTFQSQSL
RDRARRFEEALRRNTEEQLEIALAPYQHLEEDMKSLRQVLEMKNQQIHQQEKKIMELEKLAEKNIILEEKIQVLQQQNEDLKARIDQNTVV--QLSEENA
NLQEYVEKETQEKKRLSRTNEELLWKLQTGDPTSPVKLSPTSPIYRGSSSGPSSPARVSMTPR*