Sequences
EST Library Info
spc11Spinal cord
Clusters
Oligos
SNPs

Gene ID ENSG00000147588 (click for geneview)
Transcript ID ENST00000256103(link to ensembl)
Symbol PMP2
Localtion Chromosome:8:82515121:82522274:-1 band: 8q21.13
Description Myelin P2 protein. [Source:Uniprot/SWISSPROT;Acc:P02689]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------><--------------------------
-M--S--N--K--F--L--G--T--W--K--L--V--S--S--E--N--F--D--D--Y--M--K--A--L--G--V--G--L--A--T--R--K--L--
ATGAGCAACAAATTCCTGGGCACCTGGAAACTTGTCTCTAGTGAGAACTTTGACGATTACATGAAAGCTCTGGGTGTGGGGTTAGCCACCAGAAAACTGG
:::::::::::::::::.::.:::::::::::::::::.::::::::::::::.::::::::::::::::::   :::::.:::::::::::::::::::
ATGAGCAACAAATTCCTAGGTACCTGGAAACTTGTCTCCAGTGAGAACTTTGATGATTACATGAAAGCTCTG---GTGGGATTAGCCACCAGAAAACTGG
-M--S--N--K--F--L--G--T--W--K--L--V--S--S--E--N--F--D--D--Y--M--K--A--L-----V--G--L--A--T--R--K--L--

----------------------------------------------------------------------------------------------------
G--N--L--A--K--P--T--V--I--I--S--K--K--G--D--I--I--T--I--R--T--E--S--T--F--K--N--T--E--I--S--F--K--L
GAAATTTGGCCAAACCCACTGTGATCATCAGCAAGAAAGGAGATATTATAACTATACGAACTGAAAGTACCTTTAAAAATACAGAAATCTCCTTCAAGCT
::::::::::::::::::  :::::.::::::::::::::.::::::::::::::: ::::::::::::::::::::::.:::::.::::::::::::::
GAAATTTGGCCAAACCCAGAGTGATTATCAGCAAGAAAGGGGATATTATAACTATAAGAACTGAAAGTACCTTTAAAAACACAGAGATCTCCTTCAAGCT
G--N--L--A--K--P--R--V--I--I--S--K--K--G--D--I--I--T--I--R--T--E--S--T--F--K--N--T--E--I--S--F--K--L

---------------------------------------------><-----------------------------------------------------
--G--Q--E--F--E--E--T--T--A--D--N--R--K--T--K--S--I--V--T--L--Q--R--G--S--L--N--Q--V--Q--R--W--D--G-
AGGCCAGGAATTTGAAGAAACCACAGCTGACAATAGAAAGACCAAGAGCATCGTAACCCTGCAGAGAGGATCACTGAATCAAGTGCAGAGATGGGATGGC
:::::::::::::::::::::.::::::::::::::.::..: ::::::.:.::::::.::  .::::: ::.:::::::::::.::.:.::::::::::
AGGCCAGGAATTTGAAGAAACTACAGCTGACAATAGGAAAGCAAAGAGCGTTGTAACCTTGGCAAGAGGCTCGCTGAATCAAGTACAAAAATGGGATGGC
--G--Q--E--F--E--E--T--T--A--D--N--R--K--A--K--S--V--V--T--L--A--R--G--S--L--N--Q--V--Q--K--W--D--G-

-----------------------------------------------><------------------------------------------------->
-K--E--T--T--I--K--R--K--L--V--N--G--K--M--V--A--E--C--K--M--K--G--V--V--C--T--R--I--Y--E--K--V--*-
AAAGAGACAACCATAAAGAGAAAGCTAGTGAATGGGAAAATGGTAGCGGAATGTAAAATGAAGGGCGTGGTGTGCACCAGAATCTATGAGAAGGTCTGA
::::::::::: ::::::::::::::.:::.::::.:::::::::   ::::::::.:::::::..:::::::::::::::::.:::::::::::::::
AAAGAGACAACAATAAAGAGAAAGCTGGTGGATGGAAAAATGGTA---GAATGTAAGATGAAGGATGTGGTGTGCACCAGAATTTATGAGAAGGTCTGA
-K--E--T--T--I--K--R--K--L--V--D--G--K--M--V-----E--C--K--M--K--D--V--V--C--T--R--I--Y--E--K--V--*-

Pig Consensus Sequence

>BGISUST0000877471
ATGAGCAACAAATTCCTAGGTACCTGGAAACTTGTCTCCAGTGAGAACTTTGATGATTACATGAAAGCTCTG---GTGGGATTAGCCACCAGAAAACTGG
GAAATTTGGCCAAACCCAGAGTGATTATCAGCAAGAAAGGGGATATTATAACTATAAGAACTGAAAGTACCTTTAAAAACACAGAGATCTCCTTCAAGCT
AGGCCAGGAATTTGAAGAAACTACAGCTGACAATAGGAAAGCAAAGAGCGTTGTAACCTTGGCAAGAGGCTCGCTGAATCAAGTACAAAAATGGGATGGC
AAAGAGACAACAATAAAGAGAAAGCTGGTGGATGGAAAAATGGTA---GAATGTAAGATGAAGGATGTGGTGTGCACCAGAATTTATGAGAAGGTCTGA


>BGISUSP0000877471
MSNKFLGTWKLVSSENFDDYMKAL-VGLATRKLGNLAKPRVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKAKSVVTLARGSLNQVQKWDG
KETTIKRKLVDGKMV-ECKMKDVVCTRIYEKV*