Sequences
EST Library Info
cbl1Blood
pigcb1Unavailable
plac1Unavailable
ski1Skin
Clusters
Oligos
SNPs

Gene ID ENSG00000133731 (click for geneview)
Transcript ID ENST00000256108(link to ensembl)
Symbol IMPA1
Localtion Chromosome:8:82732751:82761115:-1 band: 8q21.13
Description Inositol monophosphatase (EC 3.1.3.25) (IMPase) (IMP) (Inositol-1(or 4)-monophosphatase) (Lithium-sensitive myo-inositol monophosphatase A1). [Source:Uniprot/SWISSPROT;Acc:P29218]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------><------------------------------------
-M--A--D--P--W--Q--E--C--M--D--Y--A--V--T--L--A--R--Q--A--G--E--V--V--C--E--A--I--K--N--E--M--N--V--
ATGGCTGATCCTTGGCAGGAATGCATGGATTATGCAGTAACTCTAGCAAGACAAGCTGGAGAGGTAGTTTGTGAAGCTATAAAAAATGAAATGAATGTTA
:::::.:::::::::::::::::::::::::::::::: ::.::.::.:::::::::::::::   :::.:::::::: :::::::::::::::::.:::
ATGGCCGATCCTTGGCAGGAATGCATGGATTATGCAGTTACCCTGGCGAGACAAGCTGGAGAG---GTTCGTGAAGCTCTAAAAAATGAAATGAATATTA
-M--A--D--P--W--Q--E--C--M--D--Y--A--V--T--L--A--R--Q--A--G--E-----V--R--E--A--L--K--N--E--M--N--I--

------------------------------------------------------------------------------------------------><--
M--L--K--S--S--P--V--D--L--V--T--A--T--D--Q--K--V--E--K--M--L--I--S--S--I--K--E--K--Y--P--S--H--S--F
TGCTGAAAAGTTCTCCAGTTGATTTGGTAACTGCTACGGACCAAAAAGTTGAAAAAATGCTTATCTCTTCCATAAAGGAAAAGTATCCATCTCACAGTTT
:: : :::::::::::::. ::::::::::::::::: ::: :.::::::::::::::::::::.:::::::::::::::::::::::.::::::   ::
TGATTAAAAGTTCTCCAGCGGATTTGGTAACTGCTACCGACGAGAAAGTTGAAAAAATGCTTATTTCTTCCATAAAGGAAAAGTATCCGTCTCAC---TT
M--I--K--S--S--P--A--D--L--V--T--A--T--D--E--K--V--E--K--M--L--I--S--S--I--K--E--K--Y--P--S--H-----F

----------------------------------------------------------------------------------------------------
--I--G--E--E--S--V--A--A--G--E--K--S--I--L--T--D--N--P--T--W--I--I--D--P--I--D--G--T--T--N--F--V--H-
CATTGGTGAAGAATCTGTGGCAGCTGGGGAAAAAAGTATCTTAACCGACAACCCCACATGGATCATTGACCCTATTGATGGAACAACTAACTTTGTACAT
:::::::::.:::::::::::::::::::::::::::.:::::::.:::::::: ::.:::::::: :::::::::::::::::.:::::::::::::::
CATTGGTGAGGAATCTGTGGCAGCTGGGGAAAAAAGTGTCTTAACTGACAACCCAACGTGGATCATAGACCCTATTGATGGAACGACTAACTTTGTACAT
--I--G--E--E--S--V--A--A--G--E--K--S--V--L--T--D--N--P--T--W--I--I--D--P--I--D--G--T--T--N--F--V--H-

-><--------------------------------------------><---------------------------------------------------
-R--F--P--F--V--A--V--S--I--G--F--A--V--N--K--K--I--E--F--G--V--V--Y--S--C--V--E--G--K--M--Y--T--A--
AGATTTCCTTTTGTAGCTGTTTCAATTGGCTTTGCTGTAAATAAAAAGATAGAATTTGGAGTTGTGTACAGTTGTGTGGAAGGCAAGATGTACACTGCCA
   :::::::::::.:::::::::::::::::::.::::::::::.::                                                    
---TTTCCTTTTGTGGCTGTTTCAATTGGCTTTGTTGTAAATAAAGAG----------------------------------------------------
----F--P--F--V--A--V--S--I--G--F--V--V--N--K--E-----------------------------------------------------

--------------------------------------------------------><------------------------------------------
R--K--G--K--G--A--F--C--N--G--Q--K--L--Q--V--S--Q--Q--E--D--I--T--K--S--L--L--V--T--E--L--G--S--S--R
GAAAAGGAAAAGGTGCCTTTTGTAATGGTCAAAAACTACAAGTTTCACAACAAGAAGATATTACCAAATCTCTCTTGGTGACTGAGTTGGGCTCTTCCAG
                                                           .::::::: :: ::::::::::: :::::.:::::::::::
-----------------------------------------------------------GTTACCAACTCACTCTTGGTGACAGAGTTAGGCTCTTCCAG
------------------------------------------------------------V--T--N--S--L--L--V--T--E--L--G--S--S--R

-----------------------------------------------------------------><---------------------------------
--T--P--E--T--V--R--M--V--L--S--N--M--E--K--L--F--C--I--P--V--H--G--I--R--S--V--G--T--A--A--V--N--M-
AACACCAGAGACTGTGAGAATGGTTCTTTCTAATATGGAAAAGCTTTTTTGCATTCCTGTTCATGGGATCCGGAGTGTTGGAACAGCAGCTGTTAATATG
::::::.::::::::.::::: .::::::::::::::::::.:::..::::::::::..:.:::                     :::::. ::::::::
AACACCGGAGACTGTAAGAATTATTCTTTCTAATATGGAAAGGCTCCTTTGCATTCCCATCCAT---------------------GCAGCCCTTAATATG
--T--P--E--T--V--R--I--I--L--S--N--M--E--R--L--L--C--I--P--I--H-----------------------A--A--L--N--M-

----------------------------------------------------------------------------------------------------
-C--L--V--A--T--G--G--A--D--A--Y--Y--E--M--G--I--H--C--W--D--V--A--G--A--G--I--I--V--T--E--A--G--G--
TGCCTTGTGGCAACTGGCGGAGCAGATGCATATTATGAAATGGGAATTCACTGCTGGGATGTTGCAGGAGCTGGCATTATTGTTACTGAAGCTGGTGGCG
:::.::::::::.:::: :  :::::::::: ::::::::::::::::::::::::::::.: ::::: ::::::::::::::::::::::::::::: :
TGCTTTGTGGCAGCTGGAGTTGCAGATGCATTTTATGAAATGGGAATTCACTGCTGGGATATGGCAGGTGCTGGCATTATTGTTACTGAAGCTGGTGGAG
-C--F--V--A--A--G--V--A--D--A--F--Y--E--M--G--I--H--C--W--D--M--A--G--A--G--I--I--V--T--E--A--G--G--

-----------------><---------------------------------------------------------------------------------
V--L--M--D--V--T--G--G--P--F--D--L--M--S--R--R--V--I--A--A--N--N--R--I--L--A--E--R--I--A--K--E--I--Q
TGCTAATGGATGTTACAGGTGGACCATTTGATTTGATGTCACGAAGAGTAATTGCTGCAAATAATAGAATATTAGCAGAAAGGATAGCTAAAGAAATTCA
: :: ::::::.: :::   :::::::::::::::::::::::::::::::::::: :::.:::::.:..::::: ::::::.:::::.:::::::::::
TCCTCATGGATATAACA---GGACCATTTGATTTGATGTCACGAAGAGTAATTGCTTCAAGTAATAAAGCATTAGGAGAAAGAATAGCCAAAGAAATTCA
V--L--M--D--I--T-----G--P--F--D--L--M--S--R--R--V--I--A--S--S--N--K--A--L--G--E--R--I--A--K--E--I--Q

--------------------------------->
--V--I--P--L--Q--R--D--D--E--D--*-
GGTTATACCTTTGCAACGAGACGACGAAGATTAA
:.: ::::::.: ::: ::::.::.:::::::::
GATAATACCTCTTCAAAGAGATGATGAAGATTAA
--I--I--P--L--Q--R--D--D--E--D--*-

Pig Consensus Sequence

>BGISUST0000892353
ATGGCCGATCCTTGGCAGGAATGCATGGATTATGCAGTTACCCTGGCGAGACAAGCTGGAGAG---GTTCGTGAAGCTCTAAAAAATGAAATGAATATTA
TGATTAAAAGTTCTCCAGCGGATTTGGTAACTGCTACCGACGAGAAAGTTGAAAAAATGCTTATTTCTTCCATAAAGGAAAAGTATCCGTCTCAC---TT
CATTGGTGAGGAATCTGTGGCAGCTGGGGAAAAAAGTGTCTTAACTGACAACCCAACGTGGATCATAGACCCTATTGATGGAACGACTAACTTTGTACAT
---TTTCCTTTTGTGGCTGTTTCAATTGGCTTTGTTGTAAATAAAGAG----------------------------------------------------
-----------------------------------------------------------GTTACCAACTCACTCTTGGTGACAGAGTTAGGCTCTTCCAG
AACACCGGAGACTGTAAGAATTATTCTTTCTAATATGGAAAGGCTCCTTTGCATTCCCATCCAT---------------------GCAGCCCTTAATATG
TGCTTTGTGGCAGCTGGAGTTGCAGATGCATTTTATGAAATGGGAATTCACTGCTGGGATATGGCAGGTGCTGGCATTATTGTTACTGAAGCTGGTGGAG
TCCTCATGGATATAACA---GGACCATTTGATTTGATGTCACGAAGAGTAATTGCTTCAAGTAATAAAGCATTAGGAGAAAGAATAGCCAAAGAAATTCA
GATAATACCTCTTCAAAGAGATGATGAAGATTAA


>BGISUSP0000892353
MADPWQECMDYAVTLARQAGE-VREALKNEMNIMIKSSPADLVTATDEKVEKMLISSIKEKYPSH-FIGEESVAAGEKSVLTDNPTWIIDPIDGTTNFVH
-FPFVAVSIGFVVNKE-------------------------------------VTNSLLVTELGSSRTPETVRIILSNMERLLCIPIH-------AALNM
CFVAAGVADAFYEMGIHCWDMAGAGIIVTEAGGVLMDIT-GPFDLMSRRVIASSNKALGERIAKEIQIIPLQRDDED*