Sequences
EST Library Info
cli1Liver - RNA from China
cly1Lymph - RNA from China
ebs2Foetus 50 days, brain stem
ecc1Foetus 50 days, cortex cerebri
lin1Large intestine
nje1Newborn 115 days, jejunum
pgl1Pituitary gland
ret1Retina
sag1Salivary gland
Clusters
Oligos
SNPs

Gene ID ENSG00000133935 (click for geneview)
Transcript ID ENST00000256319(link to ensembl)
Symbol ERG28_HUMAN
Localtion Chromosome:14:75186990:75196958:-1 band: 14q24.3
Description Probable ergosterol biosynthetic protein 28. [Source:Uniprot/SWISSPROT;Acc:Q9UKR5]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--R--F--L--N--V--L--R--S--W--L--V--M--V--S--I--I--A--M--G--N--T--L--Q--S--F--R--D--H--T--F--L--
ATGAGCCGTTTCCTGAATGTGTTAAGAAGTTGGCTGGTTATGGTGTCCATCATAGCCATGGGGAACACGCTGCAGAGCTTCCGAGACCACACTTTTCTCT
:::::::: ::::::::.:::::: ::::.::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::::::
ATGAGCCGGTTCCTGAACGTGTTACGAAGCTGGCTGGTCATGGTATCCATCATAGCCATGGGGAACACGCTGCAGAGCTTCCGAGACCACACCTTTCTCT
-M--S--R--F--L--N--V--L--R--S--W--L--V--M--V--S--I--I--A--M--G--N--T--L--Q--S--F--R--D--H--T--F--L--

--------------------------------><------------------------------------------------------------------
Y--E--K--L--Y--T--G--K--P--N--L--V--N--G--L--Q--A--R--T--F--G--I--W--T--L--L--S--S--V--I--R--C--L--C
ATGAAAAGCTCTACACTGGCAAGCCAAACCTTGTGAATGGCCTCCAAGCTCGGACCTTTGGGATCTGGACGCTGCTCTCATCAGTGATTCGCTGCCTCTG
::::::::::::::::.:::::::::.::      :::::::::::::::::.:::::::::::::::::.::.:::::::::.::::.:::::::::::
ATGAAAAGCTCTACACCGGCAAGCCAGAC------AATGGCCTCCAAGCTCGAACCTTTGGGATCTGGACACTACTCTCATCAATGATCCGCTGCCTCTG
Y--E--K--L--Y--T--G--K--P--D--------N--G--L--Q--A--R--T--F--G--I--W--T--L--L--S--S--M--I--R--C--L--C

-----------------------><---------------------------------------------------------------------------
--A--I--D--I--H--N--K--T--L--Y--H--I--T--L--W--T--F--L--L--A--L--G--H--F--L--S--E--L--F--V--Y--G--T-
TGCCATTGACATTCACAACAAGACGCTCTATCACATCACACTCTGGACCTTCCTCCTTGCCCTGGGGCATTTCCTCTCTGAGTTGTTTGTCTATGGAACT
.:::::.:::::.::::::      ::.::.: ::::::.::::: ::::::.::::.::::::::.::.:::::: :.:::.::::::: : .::.:::
CGCCATCGACATCCACAAC------CTTTACCTCATCACGCTCTGCACCTTCTTCCTCGCCCTGGGACACTTCCTCACCGAGCTGTTTGTATTCGGGACT
--A--I--D--I--H--N--------L--Y--L--I--T--L--C--T--F--F--L--A--L--G--H--F--L--T--E--L--F--V--F--G--T-

------------------------------------------><--------------------------------------------------------
-A--A--P--T--I--G--V--L--A--P--L--M--V--A--S--F--S--I--L--G--M--L--V--G--L--R--Y--L--E--V--E--P--V--
GCAGCTCCCACGATTGGCGTCCTGGCACCCCTGATGGTGGCAAGTTTCTCCATCCTGGGTATGCTGGTCGGGCTCCGGTATCTAGAAGTAGAACCAGTAT
::.:: :::::.::..:::::::::::::::::.::::::::      :::::::::::::::::.:: ::::: :.:::.:::::::.::::::::  :
GCGGCACCCACAATCAGCGTCCTGGCACCCCTGGTGGTGGCA------TCCATCCTGGGTATGCTAGTGGGGCTGCAGTACCTAGAAGCAGAACCAGGCT
-A--A--P--T--I--S--V--L--A--P--L--V--V--A--------S--I--L--G--M--L--V--G--L--Q--Y--L--E--A--E--P--G--

---------------------->
S--R--Q--K--K--R--N--*-
CCAGACAGAAGAAGAGAAACTGA
:::::::::::::::::::::::
CCAGACAGAAGAAGAGAAACTGA
S--R--Q--K--K--R--N--*-

Pig Consensus Sequence

>BGISUST0000882759
ATGAGCCGGTTCCTGAACGTGTTACGAAGCTGGCTGGTCATGGTATCCATCATAGCCATGGGGAACACGCTGCAGAGCTTCCGAGACCACACCTTTCTCT
ATGAAAAGCTCTACACCGGCAAGCCAGAC------AATGGCCTCCAAGCTCGAACCTTTGGGATCTGGACACTACTCTCATCAATGATCCGCTGCCTCTG
CGCCATCGACATCCACAAC------CTTTACCTCATCACGCTCTGCACCTTCTTCCTCGCCCTGGGACACTTCCTCACCGAGCTGTTTGTATTCGGGACT
GCGGCACCCACAATCAGCGTCCTGGCACCCCTGGTGGTGGCA------TCCATCCTGGGTATGCTAGTGGGGCTGCAGTACCTAGAAGCAGAACCAGGCT
CCAGACAGAAGAAGAGAAACTGA


>BGISUSP0000882759
MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPD--NGLQARTFGIWTLLSSMIRCLCAIDIHN--LYLITLCTFFLALGHFLTELFVFGT
AAPTISVLAPLVVA--SILGMLVGLQYLEAEPGSRQKKRN*