Sequences
EST Library Info
cli3Liver - RNA from China
med5Mediastinum
pgl5Pituitary gland
Clusters
Oligos
SNPs

Gene ID ENSG00000134014 (click for geneview)
Transcript ID ENST00000256398(link to ensembl)
Symbol ELP3
Localtion Chromosome:8:28006645:28104584:1 band: 8p21.1
Description elongation protein 3 homolog [Source:RefSeq_peptide;Acc:NP_060561]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------><--------------------------------------------------------------------------------
-M--R--Q--K--R--K--G--D--L--S--P--A--E--L--M--M--L--T--I--G--D--V--I--K--Q--L--I--E--A--H--E--Q--G--
ATGAGGCAGAAGCGGAAAGGAGATCTCAGCCCTGCTGAGCTGATGATGCTGACTATAGGAGATGTTATTAAACAACTGATTGAAGCCCACGAGCAGGGGA
                     ::::::::::::::.:::.:::::::::::::.:::::::::::::::::.:::::.:::::::::::.::.:::::::
---------------------GATCTCAGCCCTGCCGAGTTGATGATGCTGACCATAGGAGATGTTATTAAGCAACTAATTGAAGCCCATGAACAGGGGA
----------------------D--L--S--P--A--E--L--M--M--L--T--I--G--D--V--I--K--Q--L--I--E--A--H--E--Q--G--

------------------><--------------------------------------------------------------------------------
K--D--I--D--L--N--K--V--K--T--K--T--A--A--K--Y--G--L--S--A--Q--P--R--L--V--D--I--I--A--A--V--P--P--Q
AAGACATCGATCTAAATAAGGTGAAAACCAAGACAGCTGCCAAATATGGCCTTTCTGCCCAGCCCCGCCTGGTGGATATCATTGCTGCCGTCCCTCCTCA
:::::::.:::::.:::   ::::::::::.::::::::::::::::::::::::::: :::::::::::::::::.::::::::::: ::::: :::::
AAGACATTGATCTGAAT---GTGAAAACCAGGACAGCTGCCAAATATGGCCTTTCTGCGCAGCCCCGCCTGGTGGACATCATTGCTGCAGTCCCACCTCA
K--D--I--D--L--N-----V--K--T--R--T--A--A--K--Y--G--L--S--A--Q--P--R--L--V--D--I--I--A--A--V--P--P--Q

---------------------------------------------------------><-----------------------------------------
--Y--R--K--V--L--M--P--K--L--K--A--K--P--I--R--T--A--S--G--I--A--V--V--A--V--M--C--K--P--H--R--C--P-
GTATCGCAAGGTCTTGATGCCCAAGTTAAAGGCGAAACCCATCAGAACTGCTAGTGGGATTGCTGTCGTGGCTGTGATGTGCAAACCCCACAGATGTCCA
:::::: :::::::::.: ::::::::::::::.:::::::::::::::::.::::::::::::::.:::::::: ::::::::.:::::::::::::: 
GTATCGGAAGGTCTTGGTCCCCAAGTTAAAGGCAAAACCCATCAGAACTGCCAGTGGGATTGCTGTTGTGGCTGTCATGTGCAAGCCCCACAGATGTCCT
--Y--R--K--V--L--V--P--K--L--K--A--K--P--I--R--T--A--S--G--I--A--V--V--A--V--M--C--K--P--H--R--C--P-

----------------------------><--------------------------------------------------------------><------
-H--I--S--F--T--G--N--I--C--V--Y--C--P--G--G--P--D--S--D--F--E--Y--S--T--Q--S--Y--T--G--Y--E--P--T--
CACATCAGTTTTACAGGAAATATATGTGTATACTGCCCTGGTGGACCTGATTCTGATTTTGAGTATTCCACCCAGTCTTACACTGGCTATGAGCCAACCT
:::::::::::::::::::::::::::   ::::::::::::::::::::::: :::::::::::::: ::.:::::::::::::: :::::::::::::
CACATCAGTTTTACAGGAAATATATGT---TACTGCCCTGGTGGACCTGATTCAGATTTTGAGTATTCGACTCAGTCTTACACTGGATATGAGCCAACCT
-H--I--S--F--T--G--N--I--C-----Y--C--P--G--G--P--D--S--D--F--E--Y--S--T--Q--S--Y--T--G--Y--E--P--T--

-------------------------------------------------------------><-------------------------------------
S--M--R--A--I--R--A--R--Y--D--P--F--L--Q--T--R--H--R--I--E--Q--L--K--Q--L--G--H--S--V--D--K--V--E--F
CCATGAGAGCTATCCGTGCCAGATATGACCCTTTCCTACAGACAAGACACCGAATAGAACAGTTAAAACAACTTGGTCATAGTGTGGATAAAGTGGAGTT
::::: ::::::::::::::::.:::::::::: .::.:::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::.::
CCATGCGAGCTATCCGTGCCAGGTATGACCCTTATCTGCAGACGAGACACCGAATAGAACAGTTAAAACAACTTGGTCACAGTGTGGATAAAGTGGAATT
S--M--R--A--I--R--A--R--Y--D--P--Y--L--Q--T--R--H--R--I--E--Q--L--K--Q--L--G--H--S--V--D--K--V--E--F

----------------------------------------------------------------------------------------------------
--I--V--M--G--G--T--F--M--A--L--P--E--E--Y--R--D--Y--F--I--R--N--L--H--D--A--L--S--G--H--T--S--N--N-
TATTGTGATGGGTGGAACGTTTATGGCCCTTCCAGAAGAATACAGAGATTATTTTATTCGAAATTTACATGATGCCTTATCAGGACATACTTCCAACAAT
::::::::::::::::::.:::::::::::::::::::::::::::::.:::::::::::::::.:::::::::::::::::::.:::::.:::::::::
TATTGTGATGGGTGGAACATTTATGGCCCTTCCAGAAGAATACAGAGACTATTTTATTCGAAATCTACATGATGCCTTATCAGGGCATACCTCCAACAAT
--I--V--M--G--G--T--F--M--A--L--P--E--E--Y--R--D--Y--F--I--R--N--L--H--D--A--L--S--G--H--T--S--N--N-

----------------><----------------------------------------------------------------------------------
-I--Y--E--A--V--K--Y--S--E--R--S--L--T--K--C--I--G--I--T--I--E--T--R--P--D--Y--C--M--K--R--H--L--S--
ATTTACGAGGCAGTCAAGTATTCTGAGAGAAGCCTCACAAAGTGTATTGGAATTACTATTGAAACCAGACCAGATTACTGCATGAAGCGACATTTAAGTG
:::::.::.::::::   :::::::::::::::::::: :::::..: ::.:::::::::::.::::::::::::::: ::::::::::.:::::.::::
ATTTATGAAGCAGTC---TATTCTGAGAGAAGCCTCACCAAGTGCGTGGGGATTACTATTGAGACCAGACCAGATTACGGCATGAAGCGGCATTTGAGTG
-I--Y--E--A--V-----Y--S--E--R--S--L--T--K--C--V--G--I--T--I--E--T--R--P--D--Y--G--M--K--R--H--L--S--

------------------------------------------------------------------------------><--------------------
D--M--L--T--Y--G--C--T--R--L--E--I--G--V--Q--S--V--Y--E--D--V--A--R--D--T--N--R--G--H--T--V--K--A--V
ACATGTTGACCTATGGCTGCACAAGGCTGGAGATTGGGGTGCAGAGTGTTTATGAAGATGTGGCTAGAGACACCAACAGGGGCCACACTGTGAAGGCAGT
:::::.:::::::::::::.:::::::::::::: :::::.::::::::.:::::.::.:::::.:::::.::::::   ::::::::::::::::::::
ACATGCTGACCTATGGCTGTACAAGGCTGGAGATGGGGGTACAGAGTGTCTATGAGGACGTGGCCAGAGATACCAAC---GGCCACACTGTGAAGGCAGT
D--M--L--T--Y--G--C--T--R--L--E--M--G--V--Q--S--V--Y--E--D--V--A--R--D--T--N-----G--H--T--V--K--A--V

----------------------------------------------------------------------------------------------------
--C--E--S--F--H--L--A--K--D--S--G--F--K--V--V--A--H--M--M--P--D--L--P--N--V--G--L--E--R--D--I--E--Q-
GTGTGAGTCATTTCACCTGGCCAAAGATTCCGGTTTTAAAGTGGTGGCCCATATGATGCCTGACCTGCCAAACGTGGGACTAGAAAGAGACATTGAACAG
  ::::::::::::::::::::::::::::.:::::.::::: :::::.::::::::::::::.::::::::.:::::::: ::::::::::::::::::
TGGTGAGTCATTTCACCTGGCCAAAGATTCTGGTTTCAAAGTTGTGGCTCATATGATGCCTGATCTGCCAAATGTGGGACTTGAAAGAGACATTGAACAG
--G--E--S--F--H--L--A--K--D--S--G--F--K--V--V--A--H--M--M--P--D--L--P--N--V--G--L--E--R--D--I--E--Q-

-----><---------------------------------------------------------------------------------------------
-F--T--E--F--F--E--N--P--A--F--R--P--D--G--L--K--L--Y--P--T--L--V--I--R--G--T--G--L--Y--E--L--W--K--
TTCACAGAGTTTTTTGAGAACCCTGCTTTTCGTCCCGATGGGCTGAAACTCTATCCTACCCTGGTGATTCGTGGGACCGGGCTTTATGAGCTTTGGAAAT
::.   ::::::::::::::::::::::::::::::::::: .::::::::::.::::::::::::::::::::.::.:::::::::::::: :::::::
TTT---GAGTTTTTTGAGAACCCTGCTTTTCGTCCCGATGGTTTGAAACTCTACCCTACCCTGGTGATTCGTGGAACTGGGCTTTATGAGCTGTGGAAAT
-F-----E--F--F--E--N--P--A--F--R--P--D--G--L--K--L--Y--P--T--L--V--I--R--G--T--G--L--Y--E--L--W--K--

--------------------------------------------------------------------------------------------------->
S--G--R--Y--K--S--Y--S--P--S--D--L--V--E--L--V--A--R--I--L--A--L--V--P--P--W--T--R--V--Y--R--V--Q--R
CAGGAAGATATAAGAGTTACTCTCCTAGTGACCTGGTTGAATTGGTGGCTCGGATCCTAGCCCTCGTGCCTCCATGGACTCGAGTGTACCGAGTACAGAG
::::::::::.::::::::::::::.:::::::::.:.:::::::::::.::::::::.:::::.::.::.:::::::::::::::::::::::::::  
CAGGAAGATACAAGAGTTACTCTCCCAGTGACCTGATCGAATTGGTGGCCCGGATCCTGGCCCTTGTACCCCCATGGACTCGAGTGTACCGAGTACAG--
S--G--R--Y--K--S--Y--S--P--S--D--L--I--E--L--V--A--R--I--L--A--L--V--P--P--W--T--R--V--Y--R--V--Q---

<-----------------------------------------------------------------------------------------><--------
--D--I--P--M--P--L--V--S--S--G--V--E--H--G--N--L--R--E--L--A--L--A--R--M--K--D--L--G--I--Q--C--R--D-
GGATATTCCAATGCCTTTAGTTAGCTCAGGAGTAGAGCATGGTAACCTGAGAGAGCTGGCACTTGCAAGAATGAAAGACCTCGGAATACAGTGTCGAGAT
 :::::.:::::::::::::: ::::::::::::::::::::::::.::::::::::::::.:::::::::::::.:::::.::::::::::::::::::
-GATATCCCAATGCCTTTAGTGAGCTCAGGAGTAGAGCATGGTAACTTGAGAGAGCTGGCATTTGCAAGAATGAAGGACCTTGGAATACAGTGTCGAGAT
--D--I--P--M--P--L--V--S--S--G--V--E--H--G--N--L--R--E--L--A--F--A--R--M--K--D--L--G--I--Q--C--R--D-

--------------------------------------------------------><------------------------------------------
-V--R--T--R--E--V--G--I--Q--E--I--H--H--K--V--R--P--Y--Q--V--E--L--V--R--R--D--Y--V--A--N--G--G--W--
GTGAGAACCAGAGAAGTTGGAATCCAAGAAATTCATCACAAAGTACGGCCATACCAGGTTGAATTGGTAAGGAGAGATTATGTTGCAAATGGTGGCTGGG
::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.::::::::::::::::::::::::::::
GTGAGAACCAGAGAGGTTGGAATCCAAGAAATTCATCACAAAGTACGGCCATACCAGGTCGAATTGGTAAGAAGAGATTATGTTGCAAATGGTGGCTGGG
-V--R--T--R--E--V--G--I--Q--E--I--H--H--K--V--R--P--Y--Q--V--E--L--V--R--R--D--Y--V--A--N--G--G--W--

----------------------------------------------------------------------------------------------------
E--T--F--L--S--Y--E--D--P--D--Q--D--I--L--I--G--L--L--R--L--R--K--C--S--E--E--T--F--R--F--E--L--G--G
AAACATTCTTGTCATACGAAGACCCAGATCAAGACATTTTGATTGGCCTCCTACGATTACGCAAGTGTTCAGAAGAAACTTTCCGTTTCGAATTGGGTGG
::::::::::.:::::.:::::.::::::::::::::.::::::::::::::. :.::::: :::::::::::.::::: :::::.:::::::::: :::
AAACATTCTTATCATATGAAGATCCAGATCAAGACATCTTGATTGGCCTCCTGAGGTTACGAAAGTGTTCAGAGGAAACATTCCGCTTCGAATTGGTTGG
E--T--F--L--S--Y--E--D--P--D--Q--D--I--L--I--G--L--L--R--L--R--K--C--S--E--E--T--F--R--F--E--L--V--G

------------------------------------------------------------------------------------><--------------
--G--V--S--I--V--R--E--L--H--V--Y--G--S--V--V--P--V--S--S--R--D--P--T--K--F--Q--H--Q--G--F--G--M--L-
AGGTGTCTCCATAGTACGAGAGCTGCATGTGTATGGGAGTGTGGTCCCTGTGAGCAGCCGGGATCCTACTAAATTTCAGCATCAGGGATTTGGCATGCTG
::::::.:::::::: ::::::::::::::::::::.::::: :::::.::.:::::.::::::::.:::::::::::::::::::::::::::::::::
AGGTGTTTCCATAGTCCGAGAGCTGCATGTGTATGGAAGTGTCGTCCCCGTAAGCAGTCGGGATCCCACTAAATTTCAGCATCAGGGATTTGGCATGCTG
--G--V--S--I--V--R--E--L--H--V--Y--G--S--V--V--P--V--S--S--R--D--P--T--K--F--Q--H--Q--G--F--G--M--L-

------------------------------------------------------------------><--------------------------------
-L--M--E--E--A--E--R--I--A--R--E--E--H--G--S--G--K--I--A--V--I--S--G--V--G--T--R--N--Y--Y--R--K--I--
CTGATGGAGGAAGCAGAAAGAATAGCTAGAGAAGAACATGGGTCTGGGAAAATCGCTGTGATATCAGGGGTCGGCACCAGGAATTATTATAGAAAGATCG
:::::::::::::::::.::.::::::::::::::::::::.::::::::.:: ::::: ::::::   ::::::::::::::::::::.::::::::.:
CTGATGGAGGAAGCAGAGAGGATAGCTAGAGAAGAACATGGATCTGGGAAGATAGCTGTTATATCA---GTCGGCACCAGGAATTATTACAGAAAGATTG
-L--M--E--E--A--E--R--I--A--R--E--E--H--G--S--G--K--I--A--V--I--S-----V--G--T--R--N--Y--Y--R--K--I--

------------------------------------------->
G--Y--R--L--Q--G--P--Y--M--V--K--M--L--K--*-
GCTACAGATTACAAGGCCCGTACATGGTGAAGATGCTGAAATAA
::::::::::.:::::.::::::::::::::::.::::::::.:
GCTACAGATTGCAAGGTCCGTACATGGTGAAGACGCTGAAATGA
G--Y--R--L--Q--G--P--Y--M--V--K--T--L--K--*-

Pig Consensus Sequence

>BGISUST0000892496
---------------------GATCTCAGCCCTGCCGAGTTGATGATGCTGACCATAGGAGATGTTATTAAGCAACTAATTGAAGCCCATGAACAGGGGA
AAGACATTGATCTGAAT---GTGAAAACCAGGACAGCTGCCAAATATGGCCTTTCTGCGCAGCCCCGCCTGGTGGACATCATTGCTGCAGTCCCACCTCA
GTATCGGAAGGTCTTGGTCCCCAAGTTAAAGGCAAAACCCATCAGAACTGCCAGTGGGATTGCTGTTGTGGCTGTCATGTGCAAGCCCCACAGATGTCCT
CACATCAGTTTTACAGGAAATATATGT---TACTGCCCTGGTGGACCTGATTCAGATTTTGAGTATTCGACTCAGTCTTACACTGGATATGAGCCAACCT
CCATGCGAGCTATCCGTGCCAGGTATGACCCTTATCTGCAGACGAGACACCGAATAGAACAGTTAAAACAACTTGGTCACAGTGTGGATAAAGTGGAATT
TATTGTGATGGGTGGAACATTTATGGCCCTTCCAGAAGAATACAGAGACTATTTTATTCGAAATCTACATGATGCCTTATCAGGGCATACCTCCAACAAT
ATTTATGAAGCAGTC---TATTCTGAGAGAAGCCTCACCAAGTGCGTGGGGATTACTATTGAGACCAGACCAGATTACGGCATGAAGCGGCATTTGAGTG
ACATGCTGACCTATGGCTGTACAAGGCTGGAGATGGGGGTACAGAGTGTCTATGAGGACGTGGCCAGAGATACCAAC---GGCCACACTGTGAAGGCAGT
TGGTGAGTCATTTCACCTGGCCAAAGATTCTGGTTTCAAAGTTGTGGCTCATATGATGCCTGATCTGCCAAATGTGGGACTTGAAAGAGACATTGAACAG
TTT---GAGTTTTTTGAGAACCCTGCTTTTCGTCCCGATGGTTTGAAACTCTACCCTACCCTGGTGATTCGTGGAACTGGGCTTTATGAGCTGTGGAAAT
CAGGAAGATACAAGAGTTACTCTCCCAGTGACCTGATCGAATTGGTGGCCCGGATCCTGGCCCTTGTACCCCCATGGACTCGAGTGTACCGAGTACAG--
-GATATCCCAATGCCTTTAGTGAGCTCAGGAGTAGAGCATGGTAACTTGAGAGAGCTGGCATTTGCAAGAATGAAGGACCTTGGAATACAGTGTCGAGAT
GTGAGAACCAGAGAGGTTGGAATCCAAGAAATTCATCACAAAGTACGGCCATACCAGGTCGAATTGGTAAGAAGAGATTATGTTGCAAATGGTGGCTGGG
AAACATTCTTATCATATGAAGATCCAGATCAAGACATCTTGATTGGCCTCCTGAGGTTACGAAAGTGTTCAGAGGAAACATTCCGCTTCGAATTGGTTGG
AGGTGTTTCCATAGTCCGAGAGCTGCATGTGTATGGAAGTGTCGTCCCCGTAAGCAGTCGGGATCCCACTAAATTTCAGCATCAGGGATTTGGCATGCTG
CTGATGGAGGAAGCAGAGAGGATAGCTAGAGAAGAACATGGATCTGGGAAGATAGCTGTTATATCA---GTCGGCACCAGGAATTATTACAGAAAGATTG
GCTACAGATTGCAAGGTCCGTACATGGTGAAGACGCTGAAATGA


>BGISUSP0000892496
-------DLSPAELMMLTIGDVIKQLIEAHEQGKDIDLN-VKTRTAAKYGLSAQPRLVDIIAAVPPQYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCP
HISFTGNIC-YCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNN
IYEAV-YSERSLTKCVGITIETRPDYGMKRHLSDMLTYGCTRLEMGVQSVYEDVARDTN-GHTVKAVGESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
F-EFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWTRVYRVQ-DIPMPLVSSGVEHGNLRELAFARMKDLGIQCRD
VRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELVGGVSIVRELHVYGSVVPVSSRDPTKFQHQGFGML
LMEEAERIAREEHGSGKIAVIS-VGTRNYYRKIGYRLQGPYMVKTLK*