Sequences
EST Library Info
eje1Foetus 50 days, jejunum
fcc1Unavailable
jej1Small intestine, jejunum
lin1Large intestine
pliv2Unavailable
pro1Prostata
rec1Rectum
ret1Retina
sin1Small intestine
ski2Skin
spc1Spinal cord
spl1Spleen
thg1Thyroid gland
tra2Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000134186 (click for geneview)
Transcript ID ENST00000256579(link to ensembl)
Symbol NP_060531.1
Localtion Chromosome:1:108947005:108956462:1 band: 1p13.3
Description sarcoma antigen NY-SAR-27
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--N--N--S--P--A--L--T--G--N--S--Q--P--Q--H--Q--A--A--A--A--A--A--Q--Q--Q--Q--Q--C--G--G--G--G--
ATGGCTAACAACAGCCCCGCGCTGACAGGCAACTCGCAGCCGCAGCACCAGGCGGCTGCAGCTGCGGCTCAGCAACAGCAGCAGTGCGGCGGCGGCGGC-
:::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::.::.:::::::::::.:::::::::::::::::::::::: 
ATGGCTAACAACAGCCCCGCGCTGACAGGCAACTCGCAGCCGCAGCACCAGGCAGCCGCGGCCGCGGCTCAGCAGCAGCAGCAGTGCGGCGGCGGCGGCG
-M--A--N--N--S--P--A--L--T--G--N--S--Q--P--Q--H--Q--A--A--A--A--A--A--Q--Q--Q--Q--Q--C--G--G--G--G--

----------------------------------------------------------------------------------------------------
---------A--T--K--P--A--V--S--G--K--Q--G--N--V--L--P--L--W--G--N--E--K--T--M--N--L--N--P--M--I--L--T
--------GCTACCAAGCCGGCGGTCTCCGGCAAGCAGGGCAATGTGCTCCCGCTCTGGGGCAACGAGAAGACCATGAACCTCAACCCCATGATCCTGAC
        ::.:::::::::::.::::: :::::::::::::::::::: ::::: :::::::::::.:::::.:::::::::::::::::::::.::::
GCGGTGGCGCCACCAAGCCGGCAGTCTCGGGCAAGCAGGGCAATGTGCTGCCGCTGTGGGGCAACGAAAAGACTATGAACCTCAACCCCATGATCTTGAC
G--G--G--A--T--K--P--A--V--S--G--K--Q--G--N--V--L--P--L--W--G--N--E--K--T--M--N--L--N--P--M--I--L--T

------------------------------------------------------------------------------------><--------------
--N--I--L--S--S--P--Y--F--K--V--Q--L--Y--E--L--K--T--Y--H--E--V--V--D--E--I--Y--F--K--V--T--H--V--E-
CAACATCCTGTCGTCGCCTTACTTCAAAGTACAGCTCTACGAGCTCAAGACCTACCACGAGGTGGTGGACGAGATCTACTTTAAGGTCACGCACGTTGAA
:::.::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::::               
CAATATCCTGTCGTCGCCTTACTTCAAAGTGCAGCTCTACGAGCTCAAAACCTACCACGAGGTGGTGGACGAGATCTACTTTAAG---------------
--N--I--L--S--S--P--Y--F--K--V--Q--L--Y--E--L--K--T--Y--H--E--V--V--D--E--I--Y--F--K----------------

-----------------------------------------------------><---------------------------------------------
-P--W--E--K--G--S--R--K--T--A--G--Q--T--G--M--C--G--G--V--R--G--V--G--T--G--G--I--V--S--T--A--F--C--
CCATGGGAGAAAGGAAGCAGGAAAACAGCGGGCCAGACAGGGATGTGCGGAGGGGTTCGAGGTGTTGGAACAGGAGGAATTGTTTCTACAGCATTTTGCC
         ::::::.::::::::::::: :::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::
---------AAAGGAGGCAGGAAAACAGCTGGCCAAACAGGGATGTGCGGAGGGGTTCGAGGTGTTGGAACAGGAGGAATTGTTTCTACAGCTTTTTGCC
----------K--G--G--R--K--T--A--G--Q--T--G--M--C--G--G--V--R--G--V--G--T--G--G--I--V--S--T--A--F--C--

----------------------------------------------------------------------------------------------------
L--L--Y--K--L--F--T--L--K--L--T--R--K--Q--V--M--G--L--I--T--H--T--D--S--P--Y--I--R--A--L--G--F--M--Y
TGTTATACAAATTATTTACCCTGAAGTTAACTCGAAAGCAAGTGATGGGTCTTATAACACACACAGACTCTCCATATATTAGAGCGCTTGGATTTATGTA
:.::.::::::::::::::.:::::::::::::: :::::::::::::::::.::::::::::::::.::::::::::::::::: ::::::::::::::
TATTGTACAAATTATTTACTCTGAAGTTAACTCGCAAGCAAGTGATGGGTCTCATAACACACACAGATTCTCCATATATTAGAGCTCTTGGATTTATGTA
L--L--Y--K--L--F--T--L--K--L--T--R--K--Q--V--M--G--L--I--T--H--T--D--S--P--Y--I--R--A--L--G--F--M--Y

-----><--------------------------------------------------------------><-----------------------------
--I--R--Y--T--Q--P--P-----T--D--L--W--D--W--F--E--S--F--L--D--D--E--E--D--L--D--V--K--A--G--G--G--C-
TATAAGATATACACAGCCCCCT---ACAGATCTGTGGGACTGGTTTGAATCCTTCCTTGATGATGAAGAGGACCTAGATGTGAAGGCTGGTGGAGGCTGT
::::   ::.:::::::::::.   ::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::
TATA---TACACACAGCCCCCCC--ACAGATCTATGGGACTGGTTTGAATCCTTCCTTGATGATGAAGAGGACCTGGATGTGAAGGCTGGTGGAGGCTGT
--I-----Y--T--Q--P--P--\--T--D--L--W--D--W--F--E--S--F--L--D--D--E--E--D--L--D--V--K--A--G--G--G--C-

----------------------------------------------------------------------------------------------------
-V--M--T--I--G--E--M--L--R--S--F--L--T--K--L--E--W--F--S--T--L--F--P--R--I--P--V--P--V--Q--K--N--I--
GTAATGACCATTGGAGAAATGCTACGATCTTTTCTCACAAAACTGGAGTGGTTTTCTACCTTGTTTCCAAGAATTCCAGTTCCAGTTCAAAAGAATATTG
::::::::::::::::::::::: ::.:::::.::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::.::::::::.:
GTAATGACCATTGGAGAAATGCTTCGGTCTTTCCTCACAAAACTGGAGTGGTTTTCTACTTTGTTCCCAAGAATTCCAGTTCCAGTTCAGAAGAATATCG
-V--M--T--I--G--E--M--L--R--S--F--L--T--K--L--E--W--F--S--T--L--F--P--R--I--P--V--P--V--Q--K--N--I--

---------------------------------------------------------------------------------------------><-----
D--Q--Q--I--K--T--R--P--R--K--I--K--K--D--G--K--E--G--A--E--E--I--D--R--H--V--E--R--R--R--S--R--S--P
ATCAACAGATTAAAACCCGACCTAGAAAAATCAAGAAAGATGGGAAGGAAGGTGCTGAGGAAATAGACAGACATGTTGAACGCAGACGTTCAAGGTCTCC
:::::::::::::::::::.:: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::      :::::
ATCAACAGATTAAAACCCGGCCAAGAAAAATCAAGAAAGATGGGAAGGAAGGTGCTGAGGAAATAGACAGACATGTTGAACGCAGACGT------TCTCC
D--Q--Q--I--K--T--R--P--R--K--I--K--K--D--G--K--E--G--A--E--E--I--D--R--H--V--E--R--R--R--------S--P

----------------------------------------------------------------------------------------------------
--R--R--S--L--S--P--R--R--S--P--R--R--S--R--S--R--S--H--H--R--E--G--H--G--S--S--S--F--D--R--E--L--E-
AAGGAGATCTCTGAGTCCACGGAGGTCCCCAAGAAGGTCAAGAAGTAGAAGTCATCATCGGGAGGGCCATGGGTCTTCTAGTTTTGACAGAGAATTAGAA
::::::::: ::::::::::::::::::::::::::.:: :::::::::::.:::::::::::::::::::::::.:::::::::::: :::::.:::::
AAGGAGATCACTGAGTCCACGGAGGTCCCCAAGAAGATCCAGAAGTAGAAGCCATCATCGGGAGGGCCATGGGTCCTCTAGTTTTGACCGAGAACTAGAA
--R--R--S--L--S--P--R--R--S--P--R--R--S--R--S--R--S--H--H--R--E--G--H--G--S--S--S--F--D--R--E--L--E-

----------------------------------------------------------------------------------------------------
-R--E--K--E--R--Q--R--L--E--R--E--A--K--E--R--E--K--E--R--R--R--S--R--S--I--D--R--G--L--E--R--R--R--
AGAGAGAAAGAACGCCAGCGACTAGAGCGTGAAGCCAAAGAAAGGGAGAAAGAACGGCGAAGATCCCGAAGTATTGACCGGGGGTTAGAACGCAGGCGCA
::::::::::::::::::::::::::::::::::::::::::::.::::::::: ::::::::::::::::::::::.::::::.::::::::::::..:
AGAGAGAAAGAACGCCAGCGACTAGAGCGTGAAGCCAAAGAAAGAGAGAAAGAAAGGCGAAGATCCCGAAGTATTGATCGGGGGCTAGAACGCAGGCATA
-R--E--K--E--R--Q--R--L--E--R--E--A--K--E--R--E--K--E--R--R--R--S--R--S--I--D--R--G--L--E--R--R--H--

----------------------------------------------------------------------------------------------------
S--R--S--R--E--R--H--R--S--R--S--R--S--R--D--R--K--G--D--R--R--D--R--D--R--E--R--E--K--E--N--E--R--G
GCAGAAGTAGGGAAAGGCATAGAAGTCGCAGTCGAAGTCGTGATAGGAAAGGGGATAGAAGGGACAGGGATCGAGAAAGAGAGAAAGAAAATGAGAGAGG
::::.:::::::::::.::::::::.::.:::::::::::::::::::::::.::.:::::::::::::::::.:::::::::::::::::::::::.::
GCAGGAGTAGGGAAAGACATAGAAGCCGTAGTCGAAGTCGTGATAGGAAAGGAGACAGAAGGGACAGGGATCGGGAAAGAGAGAAAGAAAATGAGAGGGG
S--R--S--R--E--R--H--R--S--R--S--R--S--R--D--R--K--G--D--R--R--D--R--D--R--E--R--E--K--E--N--E--R--G

----------------------------------------------------------------------------------------------------
--R--R--R--D--R--D--Y--D--K--E--R--G--N--E--R--E--K--E--R--E--R--S--R--E--R--S--K--E--Q--R--S--R--G-
TAGAAGACGAGATCGTGACTATGATAAGGAAAGAGGAAATGAACGAGAAAAAGAGAGAGAGCGATCAAGAGAAAGGTCCAAGGAACAGAGAAGTAGGGGA
::::::::::::::: ::::::::.::::::::::: ::::: ::::::::.      :::::.::.:::::: ::::::::::::.: :::::::.::.
TAGAAGACGAGATCGAGACTATGACAAGGAAAGAGGTAATGACCGAGAAAAG------GAGCGGTCGAGAGAACGGTCCAAGGAACGGCGAAGTAGAGGG
--R--R--R--D--R--D--Y--D--K--E--R--G--N--D--R--E--K--------E--R--S--R--E--R--S--K--E--R--R--S--R--G-

----------------------------------------------------------------------------------------------------
-E--V--E--E--K--K--H--K--E--D--K--D--D--R--R--H--R--D--D--K--R--D--S--K--K--E--K--K--H--S--R--S--R--
GAGGTAGAAGAGAAGAAACATAAAGAAGACAAAGATGATAGGCGGCACAGAGATGACAAAAGAGATTCCAAGAAAGAGAAAAAACACAGTAGAAGCAGAA
:::::.:::::::::::.:::::::::::::::::::: ::::::::::::::::::::::.::::.::::::.::::::.::.:::::::::::.::::
GAGGTGGAAGAGAAGAAGCATAAAGAAGACAAAGATGAGAGGCGGCACAGAGATGACAAAAAAGATCCCAAGAGAGAGAAGAAGCACAGTAGAAGTAGAA
-E--V--E--E--K--K--H--K--E--D--K--D--E--R--R--H--R--D--D--K--K--D--P--K--R--E--K--K--H--S--R--S--R--

----------------------------------------------------------------------------------------------------
S--R--E--R--K--H--R--S--R--S--R--S--R--N--A--G--K--R--S--R--S--R--S--K--E--K--S--S--K--H--K--N--E--S
GCAGAGAAAGGAAACACAGAAGTAGGAGTCGAAGTAGAAATGCAGGGAAACGAAGTAGAAGTAGAAGCAAAGAGAAATCAAGTAAACATAAAAATGAAAG
::::::::::.:::::.::.::::::::: ::::::::::::: ::::::::.:::::.::.::.:::::::::::: ::::::::::::::::::::::
GCAGAGAAAGAAAACATAGGAGTAGGAGTAGAAGTAGAAATGCTGGGAAACGGAGTAGGAGCAGGAGCAAAGAGAAAGCAAGTAAACATAAAAATGAAAG
S--R--E--R--K--H--R--S--R--S--R--S--R--N--A--G--K--R--S--R--S--R--S--K--E--K--A--S--K--H--K--N--E--S

----------------------------------------------------------------------------------------------------
--K--E--K--S--N--K--R--S--R--S--G--S--Q--G--R--T--D--S--V--E--K--S--K--K--R--E--H--S--P--S--K--E--K-
TAAAGAAAAATCAAATAAACGAAGTCGAAGTGGCAGTCAAGGAAGAACTGACAGTGTTGAAAAATCAAAAAAACGGGAACATAGTCCCAGCAAAGAAAAA
:::::::::::::::::::::.::: ::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::.:::::::::::::::
TAAAGAAAAATCAAATAAACGGAGTAGAAGTGGCAGTCAAGGAAGAACTGACAGTGTTGAAAAATCAAGAAAACGGGAACATAGCCCCAGCAAAGAAAAA
--K--E--K--S--N--K--R--S--R--S--G--S--Q--G--R--T--D--S--V--E--K--S--R--K--R--E--H--S--P--S--K--E--K-

----------------------------------------------------------------------------------------------------
-S--R--K--R--S--R--S--K--E--R--S--H--K--R--D--H--S--D--S--K--D--Q--S--D--K--H--D--R--R--R--S--Q--S--
TCTAGAAAGCGTAGTAGAAGCAAAGAACGTTCCCACAAACGAGATCACAGTGATAGTAAGGACCAGTCAGACAAACATGATCGTCGAAGGAGCCAAAGTA
:::::.:::::.::.:::::::::::::::::::::::::::::::::::::::.::::::::::::: :::::::::::.::.::::::::::::::::
TCTAGGAAGCGCAGCAGAAGCAAAGAACGTTCCCACAAACGAGATCACAGTGATGGTAAGGACCAGTCTGACAAACATGACCGCCGAAGGAGCCAAAGTA
-S--R--K--R--S--R--S--K--E--R--S--H--K--R--D--H--S--D--G--K--D--Q--S--D--K--H--D--R--R--R--S--Q--S--

---------------------------------------------------->
I--E--Q--E--S--Q--E--K--Q--H--K--N--K--D--E--T--V--*-
TAGAACAAGAGAGCCAAGAAAAACAGCATAAAAACAAAGATGAGACTGTGTGA
:::::: ::::::::::::::::::.:::::::::::::: ::::::::::::
TAGAACCAGAGAGCCAAGAAAAACAACATAAAAACAAAGAGGAGACTGTGTGA
I--E--P--E--S--Q--E--K--Q--H--K--N--K--E--E--T--V--*-

Pig Consensus Sequence

>BGISUST0000889974
ATGGCTAACAACAGCCCCGCGCTGACAGGCAACTCGCAGCCGCAGCACCAGGCAGCCGCGGCCGCGGCTCAGCAGCAGCAGCAGTGCGGCGGCGGCGGCG
GCGGTGGCGCCACCAAGCCGGCAGTCTCGGGCAAGCAGGGCAATGTGCTGCCGCTGTGGGGCAACGAAAAGACTATGAACCTCAACCCCATGATCTTGAC
CAATATCCTGTCGTCGCCTTACTTCAAAGTGCAGCTCTACGAGCTCAAAACCTACCACGAGGTGGTGGACGAGATC------------------------
AAAGGAGGCAGGAAAACAGCTGGCCAAACAGGGATGTGCGGAGGGGTTCGAGGTGTTGGAACAGGAGGAATTGTTTCTACAGCTTTTTGCCTATTGTACA
AATTATTTACTCTGAAGTTAACTCGCAAGCAAGTGATGGGTCTCATAACACACACAGATTCTCCATATATTAGAGCTCTTGGATTTATGTATATA---TA
CACACAGCCCCCcaCAGATCTATGGGACTGGTTTGAATCCTTCCTTGATGATGAAGAGGACCTGGATGTGAAGGCTGGTGGAGGCTGTGTAATGACCATT
GGAGAAATGCTTCGGTCTTTCCTCACAAAACTGGAGTGGTTTTCTACTTTGTTCCCAAGAATTCCAGTTCCAGTTCAGAAGAATATCGATCAACAGATTA
AAACCCGGCCAAGAAAAATCAAGAAAGATGGGAAGGAAGGTGCTGAGGAAATAGACAGACATGTTGAACGCAGACGT------TCTCCAAGGAGATCACT
GAGTCCACGGAGGTCCCCAAGAAGATCCAGAAGTAGAAGCCATCATCGGGAGGGCCATGGGTCCTCTAGTTTTGACCGAGAACTAGAAAGAGAGAAAGAA
CGCCAGCGACTAGAGCGTGAAGCCAAAGAAAGAGAGAAAGAAAGGCGAAGATCCCGAAGTATTGATCGGGGGCTAGAACGCAGGCATAGCAGGAGTAGGG
AAAGACATAGAAGCCGTAGTCGAAGTCGTGATAGGAAAGGAGACAGAAGGGACAGGGATCGGGAAAGAGAGAAAGAAAATGAGAGGGGTAGAAGACGAGA
TCGAGACTATGACAAGGAAAGAGGTAATGACCGAGAAAAGGAGCGGTCGAGAGAACGGTCCAAGGAACGGCGAAGTAGAGGGGAGGTGGAAGAGAAGAAG
CATAAAGAAGACAAAGATGAGAGGCGGCACAGAGATGACAAAAAAGATCCCAAGAGAGAGAAGAAGCACAGTAGAAGTAGAAGCAGAGAAAGAAAACATA
GGAGTAGGAGTAGAAGTAGAAATGCTGGGAAACGGAGTAGGAGCAGGAGCAAAGAGAAAGCAAGTAAACATAAAAATGAAAGTAAAGAAAAATCAAATAA
ACGGAGTAGAAGTGGCAGTCAAGGAAGAACTGACAGTGTTGAAAAATCAAGAAAACGGGAACATAGCCCCAGCAAAGAAAAATCTAGGAAGCGCAGCAGA
AGCAAAGAACGTTCCCACAAACGAGATCACAGTGATGGTAAGGACCAGTCTGACAAACATGACCGCCGAAGGAGCCAAAGTATAGAACCAGAGAGCCAAG
AAAAACAACATAAAAACAAAGAGGAGACTGTGTGA


>BGISUSP0000889974
MANNSPALTGNSQPQHQAAAAAAQQQQQCGGGGGGGATKPAVSGKQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEI--------
KGGRKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGFMYI-YTQPPTDLWDWFESFLDDEEDLDVKAGGGCVMTI
GEMLRSFLTKLEWFSTLFPRIPVPVQKNIDQQIKTRPRKIKKDGKEGAEEIDRHVERRR--SPRRSLSPRRSPRRSRSRSHHREGHGSSSFDRELEREKE
RQRLEREAKEREKERRRSRSIDRGLERRHSRSRERHRSRSRSRDRKGDRRDRDREREKENERGRRRDRDYDKERGNDREKERSRERSKERRSRGEVEEKK
HKEDKDERRHRDDKKDPKREKKHSRSRSRERKHRSRSRSRNAGKRSRSRSKEKASKHKNESKEKSNKRSRSGSQGRTDSVEKSRKREHSPSKEKSRKRSR
SKERSHKRDHSDGKDQSDKHDRRRSQSIEPESQEKQHKNKEETV*