Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000112182 (click for geneview)
Transcript ID ENST00000257749(link to ensembl)
Symbol BACH2
Localtion Chromosome:6:90692969:91063182:-1 band: 6q15
Description Transcription regulator protein BACH2 (BTB and CNC homolog 2). [Source:Uniprot/SWISSPROT;Acc:Q9BYV9]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--V--D--E--K--P--D--S--P--M--Y--V--Y--E--S--T--V--H--C--T--N--I--L--L--G--L--N--D--Q--R--K--K--
ATGTCTGTGGATGAGAAGCCTGACTCCCCCATGTATGTGTATGAGTCCACAGTCCACTGCACCAACATCCTCCTGGGCCTCAATGACCAGCGGAAAAAGG
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::
ATGTCTGTGGATGAGAAGCCTGACTCCCCCATGTATGTGTATGAGTCCACAGTCCACTGCACCAACATCCTCCTGGGCCTCAATGACCAGCGCAAAAAGG
-M--S--V--D--E--K--P--D--S--P--M--Y--V--Y--E--S--T--V--H--C--T--N--I--L--L--G--L--N--D--Q--R--K--K--

----------------------------------------------------------------------------------------------------
D--I--L--C--D--V--T--L--I--V--E--R--K--E--F--R--A--H--R--A--V--L--A--A--C--S--E--Y--F--W--Q--A--L--V
ATATTCTCTGTGACGTGACTTTGATCGTGGAGAGGAAGGAGTTCCGGGCCCACCGGGCTGTGCTGGCCGCATGCAGTGAATATTTTTGGCAGGCGCTGGT
::::::::::::::::::::.::::::::::::::::::::::.:::::::::::: :::::::::::::.:::::::::::.::.::::::::::::::
ATATTCTCTGTGACGTGACTCTGATCGTGGAGAGGAAGGAGTTTCGGGCCCACCGGCCTGTGCTGGCCGCGTGCAGTGAATACTTCTGGCAGGCGCTGGT
D--I--L--C--D--V--T--L--I--V--E--R--K--E--F--R--A--H--R--P--V--L--A--A--C--S--E--Y--F--W--Q--A--L--V

------------------------------------------><--------------------------------------------------------
--G--Q--T--K--N--D--L--V--V--S--L--P--E--E--V--T--A--R--G--F--G--P--L--L--Q--F--A--Y--T--A--K--L--L-
TGGACAGACAAAAAATGATTTGGTGGTCAGCTTGCCTGAGGAGGTCACAGCCAGGGGCTTTGGGCCGCTGTTACAGTTTGCCTACACTGCCAAGCTGTTA
:::::::::.::: ::::.::::::::::::::::::::::::                                                         
TGGACAGACGAAACATGACTTGGTGGTCAGCTTGCCTGAGGAG---------------------------------------------------------
--G--Q--T--K--H--D--L--V--V--S--L--P--E--E----------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--S--R--E--N--I--R--E--V--I--R--C--A--E--F--L--R--M--H--N--L--E--D--S--C--F--S--F--L--Q--T--Q--L--
CTCAGCAGAGAAAACATCCGCGAGGTCATCCGCTGTGCTGAGTTCCTGCGCATGCACAACCTGGAGGACTCCTGCTTCAGCTTCCTGCAGACCCAGCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--N--S--E--D--G--L--F--V--C--R--K--D--A--A--C--Q--R--P--H--E--D--C--E--N--S--A--G--E--E--E--D--E--E
TGAACAGTGAGGATGGCCTGTTTGTGTGCCGGAAGGATGCTGCGTGCCAGCGCCCACACGAGGACTGCGAGAACTCTGCAGGAGAGGAGGAGGATGAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--E--T--M--D--S--E--T--A--K--M--A--C--P--R--D--Q--M--L--P--E--P--I--S--F--E--A--A--A--I--P--V--A-
GGAGGAGACGATGGATTCAGAGACGGCCAAGATGGCTTGCCCCAGGGACCAGATGCTTCCAGAGCCCATCAGCTTTGAGGCCGCCGCCATCCCCGTAGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--K--E--E--A--L--L--P--E--P--D--V--P--T--D--T--K--E--S--S--E--K--D--A--L--T--Q--Y--P--R--Y--K--K--
GAGAAGGAAGAAGCCCTGCTGCCCGAGCCTGACGTGCCCACAGACACCAAGGAGAGCTCAGAAAAGGACGCGTTAACGCAGTACCCCAGATACAAGAAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Y--Q--L--A--C--T--K--N--V--Y--N--A--S--S--H--S--T--S--G--F--A--S--T--F--R--E--D--N--S--S--N--S--L--K
ACCAGCTTGCATGTACCAAGAATGTCTATAATGCATCATCACACAGTACCTCAGGTTTTGCAAGCACATTCCGGGAAGATAACTCTAGCAACAGCCTCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--G--L--A--R--G--Q--I--K--S--E--P--P--S--E--E--N--E--E--E--S--I--T--L--C--L--S--G--D--E--P--D--A-
GCCGGGGCTTGCCAGGGGGCAGATTAAAAGTGAGCCGCCCAGTGAAGAGAATGAGGAAGAGAGCATCACGCTCTGCCTGTCTGGAGATGAGCCTGACGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--D--R--A--G--D--V--E--M--D--R--K--Q--P--S--P--A--P--T--P--T--A--P--A--G--A--A--C--L--E--R--S--R--
AAGGACAGAGCGGGGGATGTCGAGATGGACCGGAAACAGCCCAGCCCTGCCCCTACCCCCACGGCCCCAGCTGGGGCCGCCTGCCTGGAGAGATCCAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--V--A--S--P--S--C--L--R--S--L--F--S--I--T--K--S--V--E--L--S--G--L--P--S--T--S--Q--Q--H--F--A--R--S
GCGTGGCCTCGCCCTCCTGCTTAAGGTCTCTGTTCAGCATAACGAAAAGTGTGGAGCTGTCTGGCCTGCCCAGTACATCTCAGCAGCACTTTGCCAGGAG
                                               :::::::::.:::::::::.::: .:::: :::::::::::::::::::::::
-----------------------------------------------AGTGTGGAGTTGTCTGGCCCGCCGGGTACCTCTCAGCAGCACTTTGCCAGGAG
------------------------------------------------S--V--E--L--S--G--P--P--G--T--S--Q--Q--H--F--A--R--S

----------------------------------------------------------------------------------------------------
--P--A--C--P--F--D--K--G--I--T--Q--G--D--L--K--T--D--Y--T--P--F--T--G--N--Y--G--Q--P--H--V--G--Q--K-
TCCAGCCTGCCCTTTTGACAAGGGGATCACTCAGGGTGACCTTAAAACTGACTACACCCCTTTCACAGGGAATTATGGACAGCCCCACGTGGGCCAGAAG
:.:::: :::::::::::::::::::::: :::::::::::::::::::::::::.::::::::::.:: :::::.::::::::::::.:::::::::::
TTCAGCGTGCCCTTTTGACAAGGGGATCAGTCAGGGTGACCTTAAAACTGACTACGCCCCTTTCACGGGCAATTACGGACAGCCCCACATGGGCCAGAAG
--S--A--C--P--F--D--K--G--I--S--Q--G--D--L--K--T--D--Y--A--P--F--T--G--N--Y--G--Q--P--H--M--G--Q--K-

----------------------------------------------------------------------------------------------------
-E--V--S--N--F--T--M--G--S--P--L--R--G--P--G--L--E--A--L--C--K--Q--E--G--E--L--D--R--R--S--V--I--F--
GAGGTGTCCAACTTCACCATGGGGTCGCCCCTCAGGGGGCCTGGGTTGGAGGCTCTCTGTAAACAGGAGGGAGAGCTGGACCGGAGGAGCGTGATCTTCT
:: :.:::::.::::.: ::::::::::::::::.:::::::::::::::::::::::::::::::::.:::::::::::::::::.::.::::::::::
GACGCGTCCAGCTTCGCAATGGGGTCGCCCCTCAAGGGGCCTGGGTTGGAGGCTCTCTGTAAACAGGAAGGAGAGCTGGACCGGAGAAGTGTGATCTTCT
-D--A--S--S--F--A--M--G--S--P--L--K--G--P--G--L--E--A--L--C--K--Q--E--G--E--L--D--R--R--S--V--I--F--

----------------------------------------------------------------------------------------------------
S--S--S--A--C--D--Q--V--S--T--S--V--H--S--Y--S--G--V--S--S--L--D--K--D--L--S--E--P--V--P--K--G--L--W
CCTCCAGCGCTTGTGACCAAGTGAGCACCTCGGTGCATTCTTATTCTGGGGTGAGCAGTTTGGACAAAGACCTCTCTGAGCCGGTGCCAAAGGGTCTGTG
:.::::::::.:::::::::::::::::. :::::::.:: :::::::::::::::. ::::::::::::::::::::::::::::::::::::::::::
CTTCCAGCGCCTGTGACCAAGTGAGCACTGCGGTGCACTCGTATTCTGGGGTGAGCGCTTTGGACAAAGACCTCTCTGAGCCGGTGCCAAAGGGTCTGTG
S--S--S--A--C--D--Q--V--S--T--A--V--H--S--Y--S--G--V--S--A--L--D--K--D--L--S--E--P--V--P--K--G--L--W

----------------------------------------------------------------------------------------------------
--V--G--A--G--Q--S--L--P--S--S--Q--A--Y--S--H--G--G--L--M--A--D--H--L--P--G--R--M--R--P--N--T--S--C-
GGTGGGAGCCGGCCAGTCCCTCCCCAGCTCGCAGGCCTACTCCCACGGTGGGCTGATGGCCGACCACTTGCCAGGAAGGATGCGGCCCAACACCAGCTGC
:::.::.::::::::::::::::::: ::: :::.:::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::.::::::
GGTAGGGGCCGGCCAGTCCCTCCCCACCTCTCAGACCTACTCTCACGGTGGGCTGATGGCTGACCACTTGCCAGGAAGGATGCGGCCCAACACTAGCTGC
--V--G--A--G--Q--S--L--P--T--S--Q--T--Y--S--H--G--G--L--M--A--D--H--L--P--G--R--M--R--P--N--T--S--C-

----------------------------------------------------------------------------------------------------
-P--V--P--I--K--V--C--P--R--S--P--P--L--E--T--R--T--R--T--S--S--S--C--S--S--Y--S--Y--A--E--D--G--S--
CCGGTACCAATCAAAGTCTGCCCTCGCTCACCCCCCTTGGAGACCAGGACCAGGACTTCCAGCTCCTGCTCTTCCTATTCCTACGCGGAGGACGGGAGCG
:::::.:::::::::::::::::::::::.::::: .:::::::::::::::::::::: ::::: :::::.:: :::::::::::::::::::: ::::
CCGGTGCCAATCAAAGTCTGCCCTCGCTCGCCCCCGCTGGAGACCAGGACCAGGACTTCGAGCTCATGCTCCTCGTATTCCTACGCGGAGGACGGCAGCG
-P--V--P--I--K--V--C--P--R--S--P--P--L--E--T--R--T--R--T--S--S--S--C--S--S--Y--S--Y--A--E--D--G--S--

----------------------------------------------------------------------------------------------------
G--G--S--P--C--S--L--P--L--C--E--F--S--S--S--P--C--S--Q--G--A--R--F--L--A--T--E--H--Q--E--P--G--L--M
GGGGCTCACCCTGCAGCCTCCCTCTCTGTGAGTTCTCCTCCTCGCCCTGTTCCCAGGGAGCCAGATTCCTTGCCACAGAACATCAGGAACCAGGCCTGAT
:::::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGGGCTCGCCCTGCAGCCTCCCTCTCTGTGAGTTCTCCTCCTCACCCTGTTCCCAGGGAGCCAGATTCCTTGCCACAGAACATCAGGAACCAGGCCTGAT
G--G--S--P--C--S--L--P--L--C--E--F--S--S--S--P--C--S--Q--G--A--R--F--L--A--T--E--H--Q--E--P--G--L--M

----------------------------------------------------------------------------------------------------
--G--D--G--M--Y--N--Q--V--R--P--Q--I--K--C--E--Q--S--Y--G--T--N--S--S--D--E--S--G--S--F--S--E--A--D-
GGGAGATGGAATGTACAACCAAGTGCGGCCCCAAATTAAATGTGAGCAGTCTTATGGAACCAACTCCAGTGACGAATCCGGATCGTTCTCGGAAGCAGAC
:::::::::::::::::::::::: ::.:::::.::::::::::::::::::::.:: :::::::::::.::::::::::::::::::::::::::::::
GGGAGATGGAATGTACAACCAAGTCCGACCCCAGATTAAATGTGAGCAGTCTTACGGCACCAACTCCAGCGACGAATCCGGATCGTTCTCGGAAGCAGAC
--G--D--G--M--Y--N--Q--V--R--P--Q--I--K--C--E--Q--S--Y--G--T--N--S--S--D--E--S--G--S--F--S--E--A--D-

-----------------------------------><---------------------------------------------------------------
-S--E--S--C--P--V--Q--D--R--G--Q--E--V--K--L--P--F--P--V--D--Q--I--T--D--L--P--R--N--D--F--Q--M--M--
AGTGAGTCGTGTCCTGTGCAGGACAGGGGCCAGGAGGTAAAACTTCCTTTTCCTGTAGATCAAATCACAGATCTTCCAAGGAACGATTTCCAGATGATGA
:::::::::::::::::::::::::::::::::::::: :::::::: :::::::::::::::::::::::.::::::::::::::::::::::::::::
AGTGAGTCGTGTCCTGTGCAGGACAGGGGCCAGGAGGTCAAACTTCCGTTTCCTGTAGATCAAATCACAGACCTTCCAAGGAACGATTTCCAGATGATGA
-S--E--S--C--P--V--Q--D--R--G--Q--E--V--K--L--P--F--P--V--D--Q--I--T--D--L--P--R--N--D--F--Q--M--M--

----------------------------------------------------------------------------------------------------
I--K--M--H--K--L--T--S--E--Q--L--E--F--I--H--D--V--R--R--R--S--K--N--R--I--A--A--Q--R--C--R--K--R--K
TTAAAATGCACAAGCTAACCTCAGAACAGTTAGAGTTTATTCATGATGTCCGACGGCGCAGCAAGAACCGCATCGCGGCCCAGCGCTGCCGCAAAAGGAA
::::.::::::::::::::::::::.:::::::::::.:::::.::.:::::  ::::::::::::::::::::::.:::::::::::::::::.:::::
TTAAGATGCACAAGCTAACCTCAGAGCAGTTAGAGTTCATTCACGACGTCCGCAGGCGCAGCAAGAACCGCATCGCAGCCCAGCGCTGCCGCAAGAGGAA
I--K--M--H--K--L--T--S--E--Q--L--E--F--I--H--D--V--R--R--R--S--K--N--R--I--A--A--Q--R--C--R--K--R--K

------------------------------------------><--------------------------------------------------------
--L--D--C--I--Q--N--L--E--C--E--I--R--K--L--V--C--E--K--E--K--L--L--S--E--R--N--Q--L--K--A--C--M--G-
ACTGGACTGTATTCAGAATTTAGAATGTGAAATCCGCAAATTGGTGTGTGAGAAAGAGAAACTGTTGTCAGAGAGGAATCAACTGAAAGCATGCATGGGG
.:::::::::::::::::.:::::::::::::::::::::.:::::::::::::::::::.:::::::: :::::::::::.::::::::.:::::::::
GCTGGACTGTATTCAGAACTTAGAATGTGAAATCCGCAAACTGGTGTGTGAGAAAGAGAAGCTGTTGTCCGAGAGGAATCAGCTGAAAGCGTGCATGGGG
--L--D--C--I--Q--N--L--E--C--E--I--R--K--L--V--C--E--K--E--K--L--L--S--E--R--N--Q--L--K--A--C--M--G-

----------------------------------------------------------------------------------------------------
-E--L--L--D--N--F--S--C--L--S--Q--E--V--C--R--D--I--Q--S--P--E--Q--I--Q--A--L--H--R--Y--C--P--V--L--
GAACTGTTGGACAACTTCTCCTGCCTTTCCCAGGAAGTTTGCCGAGACATCCAGAGCCCCGAGCAGATCCAGGCCCTGCATCGGTATTGCCCTGTCCTCA
::.:::::::::::::::::::::::::::::::::::.::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::::
GAGCTGTTGGACAACTTCTCCTGCCTTTCCCAGGAAGTCTGCCGAGATATCCAGAGCCCCGAGCAGATCCAGGCCCTGCATCGGTACTGCCCTGTCCTCA
-E--L--L--D--N--F--S--C--L--S--Q--E--V--C--R--D--I--Q--S--P--E--Q--I--Q--A--L--H--R--Y--C--P--V--L--

----------------------------------------------------------------------------------------------------
R--P--M--D--L--P--T--A--S--S--I--N--P--A--P--L--G--A--E--Q--N--I--A--A--S--Q--C--A--V--G--E--N--V--P
GACCCATGGACTTGCCCACGGCCTCCAGTATTAACCCTGCGCCCTTGGGTGCTGAGCAGAACATTGCGGCCTCCCAATGCGCAGTGGGGGAAAACGTGCC
:::::.:::...: :::.:.:::::::::::::::::..::::::::::::. :::::: :: :::: .::.: :      :. ::::::     :. ::
GACCCGTGGGTCTCCCCGCAGCCTCCAGTATTAACCCCACGCCCTTGGGTGTGGAGCAGNACCTTGCCACCCCGCNNNNNNCGNTGGGGGNNNNNGCCCC
R--P--V--G--L--P--A--A--S--S--I--N--P--T--P--L--G--V--E--Q--X--L--A--T--P--X--X--X--X--G--X--X--A--P

----------------------------------------------------------------------------------------------------
--C--C--L--E--P--G--A--A--P--P--G--P--P--W--A--P--S--N--T--S--E--N--C--T--S--G--R--R--L--E--G--T--D-
CTGCTGCTTGGAGCCAGGCGCGGCTCCCCCCGGACCCCCCTGGGCACCCAGCAACACCTCCGAGAATTGTACCTCTGGGAGGAGACTAGAAGGCACTGAC
:::::::::  :       .:.:: :::                                                                        
CTGCTGCTTNNANNNNNNNACAGCACCC------------------------------------------------------------------------
--C--C--X--X--X--X--T--A--P-------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--G--T--F--S--E--R--G--P--P--L--E--P--R--S--Q--T--V--T--V--D--F--C--Q--E--M--T--D--K--C--T--T--D--
CCGGGAACCTTCTCAGAGAGAGGACCTCCTCTTGAACCCAGGAGCCAAACAGTGACCGTGGACTTCTGCCAGGAAATGACTGATAAGTGTACAACTGACG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------->
E--Q--P--R--K--D--Y--T--*-
AACAGCCCAGGAAAGATTATACCTAG
                          
--------------------------
--------------------------

Pig Consensus Sequence

>BGISUST0000903024
ATGTCTGTGGATGAGAAGCCTGACTCCCCCATGTATGTGTATGAGTCCACAGTCCACTGCACCAACATCCTCCTGGGCCTCAATGACCAGCGCAAAAAGG
ATATTCTCTGTGACGTGACTCTGATCGTGGAGAGGAAGGAGTTTCGGGCCCACCGGCCTGTGCTGGCCGCGTGCAGTGAATACTTCTGGCAGGCGCTGGT
TGGACAGACGAAACATGACTTGGTGGTCAGCTTGCCTGAGGAG---------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------AGTGTGGAGTTGTCTGGCCCGCCGGGTACCTCTCAGCAGCACTTTGCCAGGAG
TTCAGCGTGCCCTTTTGACAAGGGGATCAGTCAGGGTGACCTTAAAACTGACTACGCCCCTTTCACGGGCAATTACGGACAGCCCCACATGGGCCAGAAG
GACGCGTCCAGCTTCGCAATGGGGTCGCCCCTCAAGGGGCCTGGGTTGGAGGCTCTCTGTAAACAGGAAGGAGAGCTGGACCGGAGAAGTGTGATCTTCT
CTTCCAGCGCCTGTGACCAAGTGAGCACTGCGGTGCACTCGTATTCTGGGGTGAGCGCTTTGGACAAAGACCTCTCTGAGCCGGTGCCAAAGGGTCTGTG
GGTAGGGGCCGGCCAGTCCCTCCCCACCTCTCAGACCTACTCTCACGGTGGGCTGATGGCTGACCACTTGCCAGGAAGGATGCGGCCCAACACTAGCTGC
CCGGTGCCAATCAAAGTCTGCCCTCGCTCGCCCCCGCTGGAGACCAGGACCAGGACTTCGAGCTCATGCTCCTCGTATTCCTACGCGGAGGACGGCAGCG
GGGGCTCGCCCTGCAGCCTCCCTCTCTGTGAGTTCTCCTCCTCACCCTGTTCCCAGGGAGCCAGATTCCTTGCCACAGAACATCAGGAACCAGGCCTGAT
GGGAGATGGAATGTACAACCAAGTCCGACCCCAGATTAAATGTGAGCAGTCTTACGGCACCAACTCCAGCGACGAATCCGGATCGTTCTCGGAAGCAGAC
AGTGAGTCGTGTCCTGTGCAGGACAGGGGCCAGGAGGTCAAACTTCCGTTTCCTGTAGATCAAATCACAGACCTTCCAAGGAACGATTTCCAGATGATGA
TTAAGATGCACAAGCTAACCTCAGAGCAGTTAGAGTTCATTCACGACGTCCGCAGGCGCAGCAAGAACCGCATCGCAGCCCAGCGCTGCCGCAAGAGGAA
GCTGGACTGTATTCAGAACTTAGAATGTGAAATCCGCAAACTGGTGTGTGAGAAAGAGAAGCTGTTGTCCGAGAGGAATCAGCTGAAAGCGTGCATGGGG
GAGCTGTTGGACAACTTCTCCTGCCTTTCCCAGGAAGTCTGCCGAGATATCCAGAGCCCCGAGCAGATCCAGGCCCTGCATCGGTACTGCCCTGTCCTCA
GACCCGTGGGTCTCCCCGCAGCCTCCAGTATTAACCCCACGCCCTTGGGTGTGGAGCAGNACCTTGCCACCCCGCNNNNNNCGNTGGGGGNNNNNGCCCC
CTGCTGCTTNNANNNNNNNACAGCACCC------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------


>BGISUSP0000903024
MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRPVLAACSEYFWQALVGQTKHDLVVSLPEE-------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------SVELSGPPGTSQQHFARSSACPFDKGISQGDLKTDYAPFTGNYGQPHMGQK
DASSFAMGSPLKGPGLEALCKQEGELDRRSVIFSSSACDQVSTAVHSYSGVSALDKDLSEPVPKGLWVGAGQSLPTSQTYSHGGLMADHLPGRMRPNTSC
PVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSLPLCEFSSSPCSQGARFLATEHQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEAD
SESCPVQDRGQEVKLPFPVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMG
ELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPVGLPAASSINPTPLGVEQ-LATP----G--APCC----TAP------------------------
------------------------------------------