Sequences
EST Library Info
eep5Foetus 50 days, epidermis
fbs3Unavailable
nmm4Newborn 115 days, mucosal membranes
pgl2Pituitary gland
plac2Unavailable
plun2Unavailable
spl2Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000135336 (click for geneview)
Transcript ID ENST00000257789(link to ensembl)
Symbol ORC3L
Localtion Chromosome:6:88356562:88433885:1 band: 6q15
Description Origin recognition complex subunit 3 (Origin recognition complex subunit Latheo). [Source:Uniprot/SWISSPROT;Acc:Q9UBD5]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------><-----------------------------------------------------><--------------------
-M--A--T--S--S--M--S--K--G--C--F--V--F--K--P--N--S--K--K--R--K--I--S--L--P--I--E--D--Y--F--N--K--G--
ATGGCTACGTCCTCGATGTCTAAGGGTTGCTTTGTTTTTAAGCCAAACTCCAAAAAGAGAAAGATCTCTCTGCCAATAGAGGACTATTTTAACAAAGGGA
                                                                                 :::::::::::.:::::::
---------------------------------------------------------------------------------GACTATTTTAATAAAGGGA
----------------------------------------------------------------------------------D--Y--F--N--K--G--

----------------------------------------------------------------------------><----------------------
K--N--E--P--E--D--S--K--L--R--F--E--T--Y--Q--L--I--W--Q--Q--M--K--S--E--N--E--R--L--Q--E--E--L--N--K
AAAATGAGCCTGAGGACAGTAAGCTTCGATTCGAAACTTATCAGTTGATATGGCAGCAGATGAAATCTGAAAATGAGCGACTACAAGAGGAATTAAATAA
::::::::.::::::::::::::::::::::.:::::::::::::.:::::::::::::::::::::::::: :::::.:::::::::::::::::::::
AAAATGAGTCTGAGGACAGTAAGCTTCGATTTGAAACTTATCAGTCGATATGGCAGCAGATGAAATCTGAAACTGAGCAACTACAAGAGGAATTAAATAA
K--N--E--S--E--D--S--K--L--R--F--E--T--Y--Q--S--I--W--Q--Q--M--K--S--E--T--E--Q--L--Q--E--E--L--N--K

----------------------------------------------------------------------------------------------------
--N--L--F--D--N--L--I--E--F--L--Q--K--S--H--S--G--F--Q--K--N--S--R--D--L--G--G--Q--I--K--L--R--E--I-
AAACTTGTTTGACAATCTGATTGAATTTCTGCAAAAATCACATTCTGGATTCCAGAAGAATTCAAGAGACTTGGGCGGTCAAATAAAACTCAGAGAAATT
::::.:::::::::.:::.:::::::::::::::::::: ::::::::::::::::::::::::::::::: :::: ::::::::::.::::::::::::
AAACCTGTTTGACAGTCTAATTGAATTTCTGCAAAAATCTCATTCTGGATTCCAGAAGAATTCAAGAGACTGGGGCTGTCAAATAAAGCTCAGAGAAATT
--N--L--F--D--S--L--I--E--F--L--Q--K--S--H--S--G--F--Q--K--N--S--R--D--W--G--C--Q--I--K--L--R--E--I-

---------------------><-----------------------------------------------------------------------------
-P--T--A--A--L--V--L--G--V--N--V--T--D--H--D--L--T--F--G--S--L--T--E--A--L--Q--N--N--V--T--P--Y--V--
CCAACTGCTGCTCTTGTTCTTGGTGTGAATGTCACAGATCATGATTTGACATTCGGAAGTCTAACAGAGGCCCTTCAGAATAATGTCACACCATATGTAG
:::.::::::::::::::      :::::::: :::::::::::.::.::::::.:.:::::::::::.:::::::::::::::::::: ::::::::::
CCAGCTGCTGCTCTTGTT------GTGAATGTAACAGATCATGACTTAACATTCAGGAGTCTAACAGAAGCCCTTCAGAATAATGTCACTCCATATGTAG
-P--A--A--A--L--V--------V--N--V--T--D--H--D--L--T--F--R--S--L--T--E--A--L--Q--N--N--V--T--P--Y--V--

--------------------------><------------------------------------------------------------------------
V--S--L--Q--A--K--D--C--P--D--M--K--H--F--L--Q--K--L--I--S--Q--L--M--D--C--C--V--D--I--K--S--K--E--E
TCTCATTGCAAGCTAAAGATTGTCCAGATATGAAACATTTTTTGCAAAAGTTGATCTCACAGTTGATGGACTGCTGTGTAGATATAAAATCCAAAGAGGA
::::::::::::::::::::::::::   :: ::.:::::::::::::::.: :.::::::.:::::::::::: .:::::::.:.  ::::::::::.:
TCTCATTGCAAGCTAAAGATTGTCCA---ATTAAGCATTTTTTGCAAAAGCTCACCTCACAATTGATGGACTGCAATGTAGATGTGCCATCCAAAGAGAA
V--S--L--Q--A--K--D--C--P-----I--K--H--F--L--Q--K--L--T--S--Q--L--M--D--C--N--V--D--V--P--S--K--E--K

------------------------------------------------------------------------------><--------------------
--E--S--V--H--V--T--Q--R--K--T--H--Y--S--M--D--S--L--S--S--W--Y--M--T--V--T--Q--K--T--D--P--K--M--L-
GGAAAGTGTTCACGTCACCCAAAGAAAGACACATTATTCAATGGATTCACTTTCCAGTTGGTATATGACTGTCACACAGAAGACGGACCCAAAAATGCTA
.:::::::::::  ::::.::.:..:::::::::::::: :::::::: ::::::::::::::.:::: :::::::::::::::.:: ::::::::::.:
AGAAAGTGTTCAGTTCACTCAGAAGAAGACACATTATTCCATGGATTCTCTTTCCAGTTGGTACATGAATGTCACACAGAAGACAGAACCAAAAATGCCA
--E--S--V--Q--F--T--Q--K--K--T--H--Y--S--M--D--S--L--S--S--W--Y--M--N--V--T--Q--K--T--E--P--K--M--P-

----------------------------------------------------------------------------------------------------
-S--K--K--R--T--T--S--S--Q--W--Q--S--P--P--V--V--V--I--L--K--D--M--E--S--F--A--T--K--V--L--Q--D--F--
AGCAAAAAAAGGACTACTTCTAGCCAATGGCAGTCTCCTCCTGTTGTCGTTATCTTGAAGGATATGGAAAGCTTTGCCACAAAAGTACTACAAGACTTCA
:: :::::.:::::: :::::::::::::::::::::: ::::::::  :::::::.:::::::::::::::::..::::::::::::: ::::::::::
AGAAAAAAGAGGACTTCTTCTAGCCAATGGCAGTCTCCACCTGTTGTGCTTATCTTAAAGGATATGGAAAGCTTCACCACAAAAGTACTCCAAGACTTCA
-R--K--K--R--T--S--S--S--Q--W--Q--S--P--P--V--V--L--I--L--K--D--M--E--S--F--T--T--K--V--L--Q--D--F--

------------><--------------------------------------------------------------------------------------
I--I--I--S--S--Q--H--L--H--E--F--P--L--I--L--I--F--G--I--A--T--S--P--I--I--I--H--R--L--L--P--H--A--V
TAATTATCAGCAGTCAACATCTCCATGAATTTCCACTAATACTCATTTTTGGAATAGCCACATCTCCTATTATCATCCACCGATTGCTTCCTCATGCAGT
:::::::::::   :::::::: ::::::::::::::::: :::::.::::::                                               
TAATTATCAGC---CAACATCTACATGAATTTCCACTAATCCTCATCTTTGGA-----------------------------------------------
I--I--I--S-----Q--H--L--H--E--F--P--L--I--L--I--F--G------------------------------------------------

------------------------------------------------------------------------><--------------------------
--S--S--L--L--C--I--E--L--F--Q--S--L--S--C--K--E--H--L--T--T--V--L--D--K--L--L--L--T--T--Q--F--P--F-
ATCATCTCTATTGTGCATAGAACTGTTCCAATCTTTGTCTTGTAAGGAGCACCTGACTACGGTACTCGATAAGCTACTTCTTACAACTCAGTTTCCCTTT
                                                                         ::.:::::::::::::::::::: :::
-------------------------------------------------------------------------CTGCTTCTTACAACTCAGTTTCCATTT
--------------------------------------------------------------------------L--L--L--T--T--Q--F--P--F-

--------------------------------------------------------------------------------------><------------
-K--I--N--E--K--V--L--Q--V--L--T--N--I--F--L--Y--H--D--F--S--V--Q--N--F--I--K--G--L--Q--L--S--L--L--
AAAATAAATGAAAAAGTATTACAGGTTCTGACCAACATCTTTTTGTATCATGATTTCTCAGTTCAAAACTTTATAAAAGGACTTCAGCTTTCTCTATTAG
::: :::.:::::::::.::.:::.:::::::.::.:::::.::.:::::::::::::::.::::::::::::::::::::::.:::            :
AAACTAAGTGAAAAAGTGTTGCAGATTCTGACTAATATCTTCTTATATCATGATTTCTCAATTCAAAACTTTATAAAAGGACTCCAG------------G
-K--L--S--E--K--V--L--Q--I--L--T--N--I--F--L--Y--H--D--F--S--I--Q--N--F--I--K--G--L--Q--------------

----------------------------------------------------------------------------------------------------
E--H--F--Y--S--Q--P--L--S--V--L--C--C--N--L--P--E--A--K--R--R--I--N--F--L--S--N--N--Q--C--E--N--I--R
AGCATTTCTATTCCCAGCCCTTAAGTGTCCTGTGCTGTAATCTTCCAGAAGCCAAAAGAAGAATAAATTTTTTATCAAATAATCAATGTGAAAACATCCG
:.::::::::::::::.:::.:  . ::.::::::::::::::.:.::::::::::::::::::  .:::::::::::::::::::::::::::.:::::
AACATTTCTATTCCCAACCCCT-CANGTTCTGTGCTGTAATCTCCTAGAAGCCAAAAGAAGAATTCGTTTTTTATCAAATAATCAATGTGAAAATATCCG
E--H--F--Y--S--Q--P--L--X--V--L--C--C--N--L--L--E--A--K--R--R--I--R--F--L--S--N--N--Q--C--E--N--I--R

-----------------------><--------------------------------------------------------------><-----------
--R--L--P--S--F--R--R--Y--V--E--K--Q--A--S--E--K--Q--V--A--L--L--T--N--E--R--Y--L--K--E--E--T--Q--L-
ACGTCTACCATCTTTTAGGAGGTACGTGGAAAAGCAAGCTTCAGAAAAGCAAGTTGCGCTCTTGACCAATGAGAGATATTTGAAGGAGGAAACACAATTA
:::::: ::::: ::.:::   ::.::::::::::::::::.:::::::::::::::::::::::::::::::: :: :::::::::::::.::::::. 
ACGTCTTCCATCATTCAGG---TATGTGGAAAAGCAAGCTTTAGAAAAGCAAGTTGCGCTCTTGACCAATGAGATATTTTTGAAGGAGGAAGCACAATCC
--R--L--P--S--F--R-----Y--V--E--K--Q--A--L--E--K--Q--V--A--L--L--T--N--E--I--F--L--K--E--E--A--Q--S-

----------------------------------------------------------------------------------------------------
-L--L--E--N--L--H--V--Y--H--M--N--Y--F--L--V--L--R--C--L--H--K--F--T--S--S--L--P--K--Y--P--L--G--R--
TTACTAGAAAACCTGCATGTTTATCATATGAATTACTTCCTGGTTTTGAGATGTCTTCATAAGTTCACCTCTTCTCTTCCCAAGTATCCACTAGGTCGAC
:::::::::::::::::::::::.::::..:::::::::::::::::.::: :::::::: :::::::::::::::::::::::::.:::::.:::::::
TTACTAGAAAACCTGCATGTTTACCATACAAATTACTTCCTGGTTTTAAGAGGTCTTCATCAGTTCACCTCTTCTCTTCCCAAGTACCCACTGGGTCGAC
-L--L--E--N--L--H--V--Y--H--T--N--Y--F--L--V--L--R--G--L--H--Q--F--T--S--S--L--P--K--Y--P--L--G--R--

----><------------------------------------------------------------------------------><--------------
Q--I--R--E--L--Y--C--T--C--L--E--K--N--I--W--D--S--E--E--Y--A--S--V--L--Q--L--L--R--M--L--A--K--D--E
AGATCAGAGAGTTGTACTGTACATGTTTAGAAAAGAACATATGGGATTCAGAGGAGTATGCATCAGTCTTGCAGCTGCTGAGGATGTTGGCAAAGGATGA
::::::::::..: :::::.::::::::.:::::::::::::::::::::::::::::::::::::.:::::::::::::   :::::::::::::::::
AGATCAGAGAACTCTACTGCACATGTTTGGAAAAGAACATATGGGATTCAGAGGAGTATGCATCAGCCTTGCAGCTGCTG---ATGTTGGCAAAGGATGA
Q--I--R--E--L--Y--C--T--C--L--E--K--N--I--W--D--S--E--E--Y--A--S--A--L--Q--L--L-----M--L--A--K--D--E

----------------------------------------------------------------------------------------------------
--L--M--T--I--L--E--K--C--F--K--V--F--K--S--Y--C--E--N--H--L--G--S--T--A--K--R--I--E--E--F--L--A--Q-
ACTGATGACCATACTTGAGAAATGTTTCAAGGTTTTTAAGTCTTATTGTGAAAACCACCTTGGCAGCACAGCTAAGAGAATAGAGGAGTTCCTGGCCCAG
::::.::::::::::: :::::::::::::.::::::::::::: :: :::::: :: :::::::.:.:::: ::::.::::::::::::::::::::::
ACTGGTGACCATACTTCAGAAATGTTTCAAAGTTTTTAAGTCTTCTTCTGAAAAGCAGCTTGGCAACGCAGCAAAGAAAATAGAGGAGTTCCTGGCCCAG
--L--V--T--I--L--Q--K--C--F--K--V--F--K--S--S--S--E--K--Q--L--G--N--A--A--K--K--I--E--E--F--L--A--Q-

------------------><------------------------------------------------------------------------------><
-F--Q--S--L--D--A--E--T--K--E--E--E--D--A--S--G--S--Q--P--K--G--L--Q--K--T--D--L--Y--H--L--Q--K--S--
TTTCAGAGCCTCGATGCAGAAACCAAAGAGGAAGAAGATGCTTCTGGGTCACAGCCAAAGGGGCTTCAGAAGACAGACCTCTATCATCTTCAGAAGTCCT
:::::::::::.:::   :::.:::::::::::::::::.::::.:::::::::.:::::::::::::::::::::::::::::::::::::::::::::
TTTCAGAGCCTTGAT---GAAGCCAAAGAGGAAGAAGATACTTCCGGGTCACAGTCAAAGGGGCTTCAGAAGACAGACCTCTATCATCTTCAGAAGTCCT
-F--Q--S--L--D-----E--A--K--E--E--E--D--T--S--G--S--Q--S--K--G--L--Q--K--T--D--L--Y--H--L--Q--K--S--

--------------------------------------------------------------------------------------------------->
L--L--E--M--K--E--L--R--R-----S--K--K--Q--T--K--F--E--V--L--R--E--N--V--V--N--F--I--D--C--L--V--R--E
TATTGGAAATGAAGGAGTTAAGAAGA---AGTAAGAAGCAAACCAAATTTGAAGTACTCAGAGAAAATGTTGTGAACTTCATTGACTGTCTAGTGAGAGA
::::::::::::::::::::::::::   :::::::::::.:::::::::::::: ::::::::: : .::::::.:::::::::: ::::.:::   ::
TATTGGAAATGAAGGAGTTAAGAAGAACAAGTAAGAAGCAGACCAAATTTGAAGTCCTCAGAGAACAAATTGTGAGCTTCATTGACAGTCTGGTG---GA
L--L--E--M--K--E--L--R--R--T--S--K--K--Q--T--K--F--E--V--L--R--E--Q--I--V--S--F--I--D--S--L--V-----E

<---------------------------------------------------------------------------------------------------
--Y--L--L--P--P--E--T--Q--P--L--H--E--V--V--Y--F--S--A--A--H--A--L--R--E--H--L--N--A--A--P--R--I--A-
ATACCTTCTGCCTCCTGAGACACAGCCTCTCCATGAGGTGGTGTACTTCAGTGCTGCCCATGCCCTTCGTGAGCATTTAAATGCTGCTCCGCGAATTGCC
:.::::.::.::::: :::::::::::::: ::.::::::.::::::::::::::::::: :::::.::  ::::..:.::.::.:::::.:: ::.::.
ACACCTCCTACCTCCAGAGACACAGCCTCTGCACGAGGTGATGTACTTCAGTGCTGCCCAGGCCCTCCGACAGCACCTGAACGCCGCTCCACGTATCGCT
--H--L--L--P--P--E--T--Q--P--L--H--E--V--M--Y--F--S--A--A--Q--A--L--R--Q--H--L--N--A--A--P--R--I--A-

-----------------------------------------><---------------------------------------------------------
-L--H--T--A--L--N--N--P--Y--Y--Y--L--K--N--E--A--L--K--S--E--E--G--C--I--P--N--I--A--P--D--I--C--I--
CTCCATACTGCACTCAACAATCCTTACTATTATCTCAAGAATGAAGCACTGAAAAGCGAAGAAGGCTGCATTCCGAATATCGCCCCAGACATCTGCATAG
:::::.::.::.::::::::.:: ::.::.::.:::::::::::::::::::.:::.::::::::.::::::::.:::.::::::::::::::::::: :
CTCCACACCGCGCTCAACAACCCGTATTACTACCTCAAGAATGAAGCACTGAGAAGTGAAGAAGGTTGCATTCCAAATGTCGCCCCAGACATCTGCATCG
-L--H--T--A--L--N--N--P--Y--Y--Y--L--K--N--E--A--L--R--S--E--E--G--C--I--P--N--V--A--P--D--I--C--I--

----------------------------------------------------------><----------------------------------------
A--Y--K--L--H--L--E--C--S--R--L--I--N--L--V--D--W--S--E--A--F--A--T--V--V--T--A--A--E--K--M--D--A--N
CATACAAACTGCACCTAGAGTGTAGCAGGCTCATCAACCTCGTGGACTGGTCAGAGGCTTTTGCAACAGTTGTGACAGCTGCTGAAAAAATGGATGCAAA
::::.::.::::::::.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.
CATATAAGCTGCACCTGGAGTGTAGCAGGCTCATCAACCTTGTGGACTGGTCAGAGGCTTTTGCAACAGTTGTGACAGCTGCTGAAAAAATGGATGCAAG
A--Y--K--L--H--L--E--C--S--R--L--I--N--L--V--D--W--S--E--A--F--A--T--V--V--T--A--A--E--K--M--D--A--S

--------------------------------------><------------------------------------------------------------
--S--A--T--S--E--E--M--N--E--I--I--H--A--R--F--I--R--A--V--S--E--L--E--L--L--G--F--I--K--P--T--K--Q-
TTCTGCAACCTCAGAAGAAATGAATGAAATTATCCATGCTCGGTTTATTAGAGCTGTTTCTGAACTAGAACTTTTAGGATTTATAAAACCTACCAAACAG
:::::.:::::::::::::: :::::::::::::   :: ::::::::::::::.::::::::::::::::::::::::::::: :::::.:::::::::
TTCTGTAACCTCAGAAGAAAGGAATGAAATTATC---GCACGGTTTATTAGAGCCGTTTCTGAACTAGAACTTTTAGGATTTATCAAACCCACCAAACAG
--S--V--T--S--E--E--R--N--E--I--I-----A--R--F--I--R--A--V--S--E--L--E--L--L--G--F--I--K--P--T--K--Q-

------------------------------------------
-K--T--D--H--V--A--R--L--T--W--G--G--C--*-
AAGACTGACCATGTGGCAAGACTAACATGGGGAGGCTGCTAG
::::::::::::::::::::..::::.:::::::::::.:::
AAGACTGACCATGTGGCAAGGTTAACGTGGGGAGGCTGTTAG
-K--T--D--H--V--A--R--L--T--W--G--G--C--*-

Pig Consensus Sequence

>BGISUST0000899517
---------------------------------------------------------------------------------GACTATTTTAATAAAGGGA
AAAATGAGTCTGAGGACAGTAAGCTTCGATTTGAAACTTATCAGTCGATATGGCAGCAGATGAAATCTGAAACTGAGCAACTACAAGAGGAATTAAATAA
AAACCTGTTTGACAGTCTAATTGAATTTCTGCAAAAATCTCATTCTGGATTCCAGAAGAATTCAAGAGACTGGGGCTGTCAAATAAAGCTCAGAGAAATT
CCAGCTGCTGCTCTTGTT------GTGAATGTAACAGATCATGACTTAACATTCAGGAGTCTAACAGAAGCCCTTCAGAATAATGTCACTCCATATGTAG
TCTCATTGCAAGCTAAAGATTGTCCA---ATTAAGCATTTTTTGCAAAAGCTCACCTCACAATTGATGGACTGCAATGTAGATGTGCCATCCAAAGAGAA
AGAAAGTGTTCAGTTCACTCAGAAGAAGACACATTATTCCATGGATTCTCTTTCCAGTTGGTACATGAATGTCACACAGAAGACAGAACCAAAAATGCCA
AGAAAAAAGAGGACTTCTTCTAGCCAATGGCAGTCTCCACCTGTTGTGCTTATCTTAAAGGATATGGAAAGCTTCACCACAAAAGTACTCCAAGACTTCA
TAATTATCAGC---CAACATCTACATGAATTTCCACTAATCCTCATCTTTGGA-----------------------------------------------
-------------------------------------------------------------------------CTGCTTCTTACAACTCAGTTTCCATTT
AAACTAAGTGAAAAAGTGTTGCAGATTCTGACTAATATCTTCTTATATCATGATTTCTCAATTCAAAACTTTATAAAAGGACTCCAG------------G
AACATTTCTATTCCCAACCccANGTTCTGTGCTGTAATCTCCTAGAAGCCAAAAGAAGAATTCGTTTTTTATCAAATAATCAATGTGAAAATATCCGACG
TCTTCCATCATTCAGG---TATGTGGAAAAGCAAGCTTTAGAAAAGCAAGTTGCGCTCTTGACCAATGAGATATTTTTGAAGGAGGAAGCACAATCCTTA
CTAGAAAACCTGCATGTTTACCATACAAATTACTTCCTGGTTTTAAGAGGTCTTCATCAGTTCACCTCTTCTCTTCCCAAGTACCCACTGGGTCGACAGA
TCAGAGAACTCTACTGCACATGTTTGGAAAAGAACATATGGGATTCAGAGGAGTATGCATCAGCCTTGCAGCTGCTG---ATGTTGGCAAAGGATGAACT
GGTGACCATACTTCAGAAATGTTTCAAAGTTTTTAAGTCTTCTTCTGAAAAGCAGCTTGGCAACGCAGCAAAGAAAATAGAGGAGTTCCTGGCCCAGTTT
CAGAGCCTTGAT---GAAGCCAAAGAGGAAGAAGATACTTCCGGGTCACAGTCAAAGGGGCTTCAGAAGACAGACCTCTATCATCTTCAGAAGTCCTTAT
TGGAAATGAAGGAGTTAAGAAGAACAAGTAAGAAGCAGACCAAATTTGAAGTCCTCAGAGAACAAATTGTGAGCTTCATTGACAGTCTG---GAACACCT
CCTACCTCCAGAGACACAGCCTCTGCACGAGGTGATGTACTTCAGTGCTGCCCAGGCCCTCCGACAGCACCTGAACGCCGCTCCACGTATCGCTCTCCAC
ACCGCGCTCAACAACCCGTATTACTACCTCAAGAATGAAGCACTGAGAAGTGAAGAAGGTTGCATTCCAAATGTCGCCCCAGACATCTGCATCGCATATA
AGCTGCACCTGGAGTGTAGCAGGCTCATCAACCTTGTGGACTGGTCAGAGGCTTTTGCAACAGTTGTGACAGCTGCTGAAAAAATGGATGCAAGTTCTGT
AACCTCAGAAGAAAGGAATGAAATTATC---GCACGGTTTATTAGAGCCGTTTCTGAACTAGAACTTTTAGGATTTATCAAACCCACCAAACAGAAGACT
GACCATGTGGCAAGGTTAACGTGGGGAGGCTGTTAG


>BGISUSP0000899517
---------------------------DYFNKGKNESEDSKLRFETYQSIWQQMKSETEQLQEELNKNLFDSLIEFLQKSHSGFQKNSRDWGCQIKLREI
PAAALV--VNVTDHDLTFRSLTEALQNNVTPYVVSLQAKDCP-IKHFLQKLTSQLMDCNVDVPSKEKESVQFTQKKTHYSMDSLSSWYMNVTQKTEPKMP
RKKRTSSSQWQSPPVVLILKDMESFTTKVLQDFIIIS-QHLHEFPLILIFG----------------------------------------LLLTTQFPF
KLSEKVLQILTNIFLYHDFSIQNFIKGLQ----EHFYSQP-VLCCNLLEAKRRIRFLSNNQCENIRRLPSFR-YVEKQALEKQVALLTNEIFLKEEAQSL
LENLHVYHTNYFLVLRGLHQFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASALQLL-MLAKDELVTILQKCFKVFKSSSEKQLGNAAKKIEEFLAQF
QSLD-EAKEEEDTSGSQSKGLQKTDLYHLQKSLLEMKELRRTSKKQTKFEVLREQIVSFIDSL-EHLLPPETQPLHEVMYFSAAQALRQHLNAAPRIALH
TALNNPYYYLKNEALRSEEGCIPNVAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAEKMDASSVTSEERNEII-ARFIRAVSELELLGFIKPTKQKT
DHVARLTWGGC*