Sequences
EST Library Info
che2Heart - RNA from China
cki1Kidney - RNA from China
ova2Ovary
pfco1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000135643 (click for geneview)
Transcript ID ENST00000258111(link to ensembl)
Symbol KCMB4_HUMAN
Localtion Chromosome:12:69046329:69111245:1 band: 12q15
Description Calcium-activated potassium channel beta subunit 4 (Calcium-activated potassium channel, subfamily M, beta subunit 4) (Maxi K channel beta subunit 4) (BK channel beta subunit 4) (Slo-beta 4) (K(VCA)beta 4) (Charybdotoxin receptor beta subunit 4) (BKbeta4)
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--K--L--R--V--A--Y--E--Y--T--E--A--E--D--K--S--I--R--L--G--L--F--L--I--I--S--G--V--V--S--L--F--
ATGGCGAAGCTCCGGGTGGCTTACGAGTACACGGAAGCCGAGGACAAGAGCATCCGGCTCGGCTTGTTTCTCATCATCTCCGGCGTCGTGTCGCTCTTCA
            ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:
------------CGGGTGGCTTACGAGTACACGGAAGCCGAGGACAAGAGCATCCGGCTCGGCTTGTTTCTCATCATCTCCGGCGTCGTGTCGCTCTTTA
-------------R--V--A--Y--E--Y--T--E--A--E--D--K--S--I--R--L--G--L--F--L--I--I--S--G--V--V--S--L--F--

----------------------------------------------------------------------------------------------------
I--F--G--F--C--W--L--S--P--A--L--Q--D--L--Q--A--T--E--A--N--C--T--V--L--S--V--Q--Q--I--G--E--V--F--E
TCTTCGGCTTCTGCTGGCTGAGTCCCGCGCTGCAGGATCTGCAAGCCACGGAGGCCAATTGCACGGTGCTGTCGGTGCAGCAGATCGGCGAGGTGTTCGA
::::::::::::::::::: ::::::::::::::::::::::::::::::: ::::::.:::::::::::::::::::::::::::::::::::::::::
TCTTCGGCTTCTGCTGGCTCAGTCCCGCGCTGCAGGATCTGCAAGCCACGGCGGCCAACTGCACGGTGCTGTCGGTGCAGCAGATCGGCGAGGTGTTCGA
I--F--G--F--C--W--L--S--P--A--L--Q--D--L--Q--A--T--A--A--N--C--T--V--L--S--V--Q--Q--I--G--E--V--F--E

----------------------------------------------------------------------------------------------------
--C--T--F--T--C--G--A--D--C--R--G--T--S--Q--Y--P--C--V--Q--V--Y--V--N--N--S--E--S--N--S--R--A--L--L-
GTGCACCTTCACCTGTGGCGCCGACTGCAGGGGCACCTCGCAGTACCCCTGCGTCCAGGTCTACGTGAACAACTCTGAGTCCAACTCTAGGGCGCTGCTG
:::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::.:::::.:::::.::::::::.:::
GTGCACCTTCACCTGTGGCGCCGACTGCAGGGGCACCTCGCAGTACCCGTGCGTCCAGGTCTACGTGAACAACTCCGAGTCTAACTCCAGGGCGCTACTG
--C--T--F--T--C--G--A--D--C--R--G--T--S--Q--Y--P--C--V--Q--V--Y--V--N--N--S--E--S--N--S--R--A--L--L-

-----------------------------------><---------------------------------------------------------------
-H--S--D--E--H--Q--L--L--T--N--P--K--C--S--Y--I--P--P--C--K--R--E--N--Q--K--N--L--E--S--V--M--N--W--
CACAGCGACGAGCACCAGCTCCTGACCAACCCCAAGTGCTCCTATATCCCTCCCTGTAAGAGAGAAAATCAGAAGAATTTGGAAAGTGTCATGAATTGGC
::::::::::::::::::::::::::::::::::::               ::::::::::::::::::::::::::.::::::::::::::::::::::
CACAGCGACGAGCACCAGCTCCTGACCAACCCCAAG---------------CCCTGTAAGAGAGAAAATCAGAAGAACTTGGAAAGTGTCATGAATTGGC
-H--S--D--E--H--Q--L--L--T--N--P--K-----------------P--C--K--R--E--N--Q--K--N--L--E--S--V--M--N--W--

---------------------------------------------------------------><-----------------------------------
Q--Q--Y--W--K--D--E--I--G--S--Q--P--F--T--C--Y--F--N--Q--H--Q--R--P--D--D--V--L--L--H--R--T--H--D--E
AACAGTACTGGAAAGATGAGATTGGTTCCCAGCCATTTACTTGCTATTTTAATCAACATCAAAGACCAGATGATGTGCTTCTGCATCGCACTCATGATGA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::. ::::   ::.::.::::::::.::::::::::::::::::::
AACAGTACTGGAAAGATGAGATTGGTTCCCAGCCATTTACTTGCTATTTTAATCAATTTCAA---CCGGACGATGTGCTCCTGCATCGCACTCATGATGA
Q--Q--Y--W--K--D--E--I--G--S--Q--P--F--T--C--Y--F--N--Q--F--Q-----P--D--D--V--L--L--H--R--T--H--D--E

----------------------------------------------------------------------------------------------------
--I--V--L--L--H--C--F--L--W--P--L--V--T--F--V--V--G--V--L--I--V--V--L--T--I--C--A--K--S--L--A--V--K-
GATTGTCCTCCTGCATTGCTTCCTCTGGCCCCTGGTGACATTTGTGGTGGGCGTTCTCATTGTGGTCCTGACCATCTGTGCCAAGAGCTTGGCGGTCAAG
:::.::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::.::::.::::::
GATCGTCCTCCTGCATTGCTTCCTCTGGCCCCTGGTGACATTCGTGGTGGGCGTTCTCATTGTGGTCCTGACCATCTGTGCCAAGAGCCTGGCAGTCAAG
--I--V--L--L--H--C--F--L--W--P--L--V--T--F--V--V--G--V--L--I--V--V--L--T--I--C--A--K--S--L--A--V--K-

-------------------------------->
-A--E--A--M--K--K--R--K--F--S--*-
GCGGAAGCCATGAAGAAGCGCAAGTTCTCTTAA
::.::::::::::::::::::::::::::::::
GCAGAAGCCATGAAGAAGCGCAAGTTCTCTTAA
-A--E--A--M--K--K--R--K--F--S--*-

Pig Consensus Sequence

>BGISUST0000900737
------------CGGGTGGCTTACGAGTACACGGAAGCCGAGGACAAGAGCATCCGGCTCGGCTTGTTTCTCATCATCTCCGGCGTCGTGTCGCTCTTTA
TCTTCGGCTTCTGCTGGCTCAGTCCCGCGCTGCAGGATCTGCAAGCCACGGCGGCCAACTGCACGGTGCTGTCGGTGCAGCAGATCGGCGAGGTGTTCGA
GTGCACCTTCACCTGTGGCGCCGACTGCAGGGGCACCTCGCAGTACCCGTGCGTCCAGGTCTACGTGAACAACTCCGAGTCTAACTCCAGGGCGCTACTG
CACAGCGACGAGCACCAGCTCCTGACCAACCCCAAG---------------CCCTGTAAGAGAGAAAATCAGAAGAACTTGGAAAGTGTCATGAATTGGC
AACAGTACTGGAAAGATGAGATTGGTTCCCAGCCATTTACTTGCTATTTTAATCAATTTCAA---CCGGACGATGTGCTCCTGCATCGCACTCATGATGA
GATCGTCCTCCTGCATTGCTTCCTCTGGCCCCTGGTGACATTCGTGGTGGGCGTTCTCATTGTGGTCCTGACCATCTGTGCCAAGAGCCTGGCAGTCAAG
GCAGAAGCCATGAAGAAGCGCAAGTTCTCTTAA


>BGISUSP0000900737
----RVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATAANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALL
HSDEHQLLTNPK-----PCKRENQKNLESVMNWQQYWKDEIGSQPFTCYFNQFQ-PDDVLLHRTHDEIVLLHCFLWPLVTFVVGVLIVVLTICAKSLAVK
AEAMKKRKFS*