Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000136213 (click for geneview)
Transcript ID ENST00000258711(link to ensembl)
Symbol CHST12
Localtion Chromosome:7:2245437:2247455:1 band: 7p22.3
Description Carbohydrate sulfotransferase 12 (EC 2.8.2.5) (Chondroitin 4-O- sulfotransferase 2) (Chondroitin 4-sulfotransferase 2) (C4ST2) (C4ST- 2) (Sulfotransferase Hlo). [Source:Uniprot/SWISSPROT;Acc:Q9NRB3]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--K--A--R--L--F--R--L--W--L--V--L--G--S--V--F--M--I--L--L--I--I--V--Y--W--D--S--A--G--A--A--H--
ATGACCAAGGCCCGGCTGTTCCGGCTGTGGCTGGTGCTGGGGTCGGTGTTCATGATCCTGCTGATCATCGTGTACTGGGACAGCGCAGGCGCCGCGCACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--Y--L--H--T--S--F--S--R--P--H--T--G--P--P--L--P--T--P--G--P--D--R--D--R--E--L--T--A--D--S--D--V--D
TCTACTTGCACACGTCCTTCTCTAGGCCGCACACGGGGCCGCCGCTGCCCACGCCCGGGCCGGACAGGGACAGGGAGCTCACGGCCGACTCCGATGTCGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--F--L--D--K--F--L--S--A--G--V--K--Q--S--D--L--P--R--K--E--T--E--Q--P--P--A--P--G--S--M--E--E--S-
CGAGTTTCTGGACAAGTTTCTCAGTGCTGGCGTGAAGCAGAGCGACCTTCCCAGAAAGGAGACGGAGCAGCCGCCTGCGCCGGGGAGCATGGAGGAGAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--R--G--Y--D--W--S--P--R--D--A--R--R--S--P--D--Q--G--R--Q--Q--A--E--R--R--S--V--L--R--G--F--C--A--
GTGAGAGGCTACGACTGGTCCCCGCGCGACGCCCGGCGCAGCCCAGACCAGGGCCGGCAGCAGGCGGAGCGGAGGAGCGTGCTGCGGGGCTTCTGCGCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--S--S--L--A--F--P--T--K--E--R--A--F--D--D--I--P--N--S--E--L--S--H--L--I--V--D--D--R--H--G--A--I--Y
ACTCCAGCCTGGCCTTCCCCACCAAGGAGCGCGCATTCGACGACATCCCCAACTCGGAGCTGAGCCACCTGATCGTGGACGACCGGCACGGGGCCATCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--C--Y--V--P--K--V--A--C--T--N--W--K--R--V--M--I--V--L--S--G--S--L--L--H--R--G--A--P--Y--R--D--P--L-
CTGCTACGTGCCCAAGGTGGCCTGCACCAACTGGAAGCGCGTGATGATCGTGCTGAGCGGAAGCCTGCTGCACCGCGGTGCGCCCTACCGCGACCCGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--I--P--R--E--H--V--H--N--A--S--A--H--L--T--F--N--K--F--W--R--R--Y--G--K--L--S--R--H--L--M--K--V--
CGCATCCCGCGCGAGCACGTGCACAACGCCAGCGCGCACCTGACCTTCAACAAGTTCTGGCGCCGCTACGGGAAGCTCTCCCGCCACCTCATGAAGGTCA
   ::::: ::::::.::::::::::: :::::.:::::::::::::::::::::::::::: :::::::: :::.:::: :::::::::::::::.:::
---ATCCCCCGCGAGTACGTGCACAACTCCAGCACGCACCTGACCTTCAACAAGTTCTGGCGGCGCTACGGCAAGTTCTCGCGCCACCTCATGAAGATCA
----I--P--R--E--Y--V--H--N--S--S--T--H--L--T--F--N--K--F--W--R--R--Y--G--K--F--S--R--H--L--M--K--I--

----------------------------------------------------------------------------------------------------
K--L--K--K--Y--T--K--F--L--F--V--R--D--P--F--V--R--L--I--S--A--F--R--S--K--F--E--L--E--N--E--E--F--Y
AGCTCAAGAAGTACACCAAGTTCCTCTTCGTGCGCGACCCCTTCGTGCGCCTGATCTCCGCCTTCCGCAGCAAGTTCGAGCTGGAGAACGAGGAGTTCTA
:::: :::::::::::::::::::: :::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::
AGCTGAAGAAGTACACCAAGTTCCTGTTCGTGCGCGACCCCTTCGTGCGCCTCATCTCCGCCTTCCGCAGCAAGTTCGAGCTGGAGAACGAGGAGTTCTA
K--L--K--K--Y--T--K--F--L--F--V--R--D--P--F--V--R--L--I--S--A--F--R--S--K--F--E--L--E--N--E--E--F--Y

----------------------------------------------------------------------------------------------------
--R--K--F--A--V--P--M--L--R--L--Y--A--N--H--T--S--L--P--A--S--A--R--E--A--F--R--A--G--L--K--V--S--F-
CCGCAAGTTCGCCGTGCCCATGCTGCGGCTGTACGCCAACCACACCAGCCTGCCCGCCTCGGCGCGCGAGGCCTTCCGCGCTGGCCTCAAGGTGTCCTTC
::::::::::::::: ::::::::::.: ::::: :::::::::::::::..::::: :: :.  ::::::::::: ::::.:::::::.::::::::::
CCGCAAGTTCGCCGTCCCCATGCTGCAGATGTACTCCAACCACACCAGCCCACCCGCGTCCGTCAGCGAGGCCTTCAGCGCCGGCCTCAGGGTGTCCTTC
--R--K--F--A--V--P--M--L--Q--M--Y--S--N--H--T--S--P--P--A--S--V--S--E--A--F--S--A--G--L--R--V--S--F-

----------------------------------------------------------------------------------------------------
-A--N--F--I--Q--Y--L--L--D--P--H--T--E--K--L--A--P--F--N--E--H--W--R--Q--V--Y--R--L--C--H--P--C--Q--
GCCAACTTCATCCAGTACCTGCTGGACCCGCACACGGAGAAGCTGGCGCCCTTCAACGAGCACTGGCGGCAGGTGTACCGCCTCTGCCACCCGTGCCAGA
::::::::::::::::::::::::::::: ::::: ::: :::::::::::::::::::::::::::::::::::.:::::::::::::::: :::::::
GCCAACTTCATCCAGTACCTGCTGGACCCCCACACCGAGCAGCTGGCGCCCTTCAACGAGCACTGGCGGCAGGTGCACCGCCTCTGCCACCCCTGCCAGA
-A--N--F--I--Q--Y--L--L--D--P--H--T--E--Q--L--A--P--F--N--E--H--W--R--Q--V--H--R--L--C--H--P--C--Q--

----------------------------------------------------------------------------------------------------
I--D--Y--D--F--V--G--K--L--E--T--L--D--E--D--A--A--Q--L--L--Q--L--L--Q--V--D--R--Q--L--R--F--P--P--S
TCGACTACGACTTCGTGGGGAAGCTGGAGACTCTGGACGAGGACGCCGCGCAGCTGCTGCAGCTACTCCAGGTGGACCGGCAGCTCCGCTTCCCCCCGAG
: ::::::::::::::::: :::::::::::.:::::: ::::::::::::::::::: :.::: :..::::::::. .:: ::: :.:::::::     
TAGACTACGACTTCGTGGGCAAGCTGGAGACCCTGGACCAGGACGCCGCGCAGCTGCTCCGGCTCCCTCAGGTGGATAAGCTGCTGCACTTCCCC-----
I--D--Y--D--F--V--G--K--L--E--T--L--D--Q--D--A--A--Q--L--L--R--L--P--Q--V--D--K--L--L--H--F--P------

----------------------------------------------------------------------------------------------------
--Y--R--N--R--T--A--S--S--W--E--E--D--W--F--A--K--I--P--L--A--W--R--Q--Q--L--Y--K--L--Y--E--A--D--F-
CTACCGGAACAGGACCGCCAGCAGCTGGGAGGAGGACTGGTTCGCCAAGATCCCCCTGGCCTGGAGGCAGCAGCTGTATAAACTCTACGAGGCCGACTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------->
-V--L--F--G--Y--P--K--P--E--N--L--L--R--D--*-
GTTCTCTTCGGCTACCCCAAGCCCGAAAACCTCCTCCGAGACTGA
                                             
---------------------------------------------
---------------------------------------------

Pig Consensus Sequence

>BGISUST0000879306
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---ATCCCCCGCGAGTACGTGCACAACTCCAGCACGCACCTGACCTTCAACAAGTTCTGGCGGCGCTACGGCAAGTTCTCGCGCCACCTCATGAAGATCA
AGCTGAAGAAGTACACCAAGTTCCTGTTCGTGCGCGACCCCTTCGTGCGCCTCATCTCCGCCTTCCGCAGCAAGTTCGAGCTGGAGAACGAGGAGTTCTA
CCGCAAGTTCGCCGTCCCCATGCTGCAGATGTACTCCAACCACACCAGCCCACCCGCGTCCGTCAGCGAGGCCTTCAGCGCCGGCCTCAGGGTGTCCTTC
GCCAACTTCATCCAGTACCTGCTGGACCCCCACACCGAGCAGCTGGCGCCCTTCAACGAGCACTGGCGGCAGGTGCACCGCCTCTGCCACCCCTGCCAGA
TAGACTACGACTTCGTGGGCAAGCTGGAGACCCTGGACCAGGACGCCGCGCAGCTGCTCCGGCTCCCTCAGGTGGATAAGCTGCTGCACTTCCCC-----
----------------------------------------------------------------------------------------------------
---------------------------------------------


>BGISUSP0000879306
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-IPREYVHNSSTHLTFNKFWRRYGKFSRHLMKIKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLQMYSNHTSPPASVSEAFSAGLRVSF
ANFIQYLLDPHTEQLAPFNEHWRQVHRLCHPCQIDYDFVGKLETLDQDAAQLLRLPQVDKLLHFP-----------------------------------
---------------