Sequences
EST Library Info
fat5Fatt
Clusters
Oligos
SNPs

Gene ID ENSG00000136267 (click for geneview)
Transcript ID ENST00000258767(link to ensembl)
Symbol DGKB
Localtion Chromosome:7:13960485:14654128:-1 band: 7p21.2
Description Diacylglycerol kinase, beta (EC 2.7.1.107) (Diglyceride kinase) (DGK- beta) (DAG kinase beta) (90 kDa diacylglycerol kinase). [Source:Uniprot/SWISSPROT;Acc:Q9Y6T7]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------><-----------------------------
-M--T--N--Q--E--K--W--A--H--L--S--P--S--E--F--S--Q--L--Q--K--Y--A--E--Y--S--T--K--K--L--K--D--V--L--
ATGACAAACCAGGAAAAATGGGCCCACCTCAGCCCTTCGGAATTTTCCCAACTTCAGAAATATGCTGAGTATTCTACAAAGAAATTAAAGGATGTTCTTG
                                                                        :::::::::::::::::.::::::::::
------------------------------------------------------------------------TCTACAAAGAAATTAAAAGATGTTCTTG
-------------------------------------------------------------------------S--T--K--K--L--K--D--V--L--

----------------------------------------------><-------------------><-------------------------------
E--E--F--H--G--N--G--V--L--A--K--Y--N--P--E--G--L--E--I--F--M--S--S--T--I--D--F--E--G--F--K--L--F--M
AAGAATTCCATGGTAATGGTGTGCTTGCAAAGTATAATCCTGAAGGGCTAGAAATATTTATGTCTTCAACAATAGATTTTGAAGGTTTCAAACTATTCAT
:::::::::::::::::::::::::::::::::::::::::::::::                                                     
AAGAATTCCATGGTAATGGTGTGCTTGCAAAGTATAATCCTGAAGGG-----------------------------------------------------
E--E--F--H--G--N--G--V--L--A--K--Y--N--P--E--G------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--T--F--L--E--A--E--L--P--D--D--F--T--A--H--L--F--M--S--F--S--N--K--F--P--H--S--S--P--M--V--K--S-
GAAGACATTCCTGGAAGCCGAGCTTCCTGATGATTTCACTGCACACCTTTTCATGTCATTTAGCAACAAGTTTCCTCATTCTAGTCCAATGGTAAAAAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------><-----------------------------------------------------------------------------
-K--P--A--L--L--S--G--G--L--R--M--N--K--G--A--I--T--P--P--R--T--T--S--P--A--N--T--C--S--P--E--V--I--
AAGCCTGCTCTCCTATCAGGCGGTCTGAGAATGAATAAAGGTGCCATCACCCCTCCCCGGACTACTTCTCCTGCAAATACGTGTTCCCCAGAAGTAATCC
                        ::::::::::::::::: :::::::::::::: ::    :::::::: :::::: :::::::::: :::::.::::
------------------------CTGAGAATGAATAAAGGGGCCATCACCCCTCCACGT---ACTTCTCCAGCAAATTCGTGTTCCCCCGAAGTGATCC
-------------------------L--R--M--N--K--G--A--I--T--P--P--R-----T--S--P--A--N--S--C--S--P--E--V--I--

-----------------------------------------------------------------><---------------------------------
H--L--K--D--I--V--C--Y--L--S--L--L--E--R--G--R--P--E--D--K--L--E--F--M--F--R--L--Y--D--T--D--G--N--G
ATCTGAAGGACATTGTCTGTTACCTGTCTCTGCTTGAAAGAGGAAGACCTGAGGATAAGCTTGAGTTTATGTTTCGCCTTTATGACACGGATGGGAATGG
:::::::::::::::::::.::::::::::: ::::::::::::::::::::::::::.:: :::   :::::::::::.::::::::::::::.:::::
ATCTGAAGGACATTGTCTGCTACCTGTCTCTCCTTGAAAGAGGAAGACCTGAGGATAAACTGGAG---ATGTTTCGCCTCTATGACACGGATGGAAATGG
H--L--K--D--I--V--C--Y--L--S--L--L--E--R--G--R--P--E--D--K--L--E-----M--F--R--L--Y--D--T--D--G--N--G

---------------><-------------------------------------------------------------------------><--------
--F--L--D--S--S--E--L--E--N--I--I--S--Q--M--M--H--V--A--E--Y--L--E--W--D--V--T--E--L--N--P--I--L--H-
CTTCCTGGACAGCTCGGAGCTAGAAAATATCATCAGTCAGATGATGCATGTTGCAGAATACCTTGAGTGGGATGTCACTGAACTTAATCCAATCCTCCAT
::::::::::::.:::::.:::::::::::::::::::::::::::::::: :::::.::::::::.:::::::::::::::::::::::::::::::::
CTTCCTGGACAGTTCGGAACTAGAAAATATCATCAGTCAGATGATGCATGTGGCAGAGTACCTTGAATGGGATGTCACTGAACTTAATCCAATCCTCCAT
--F--L--D--S--S--E--L--E--N--I--I--S--Q--M--M--H--V--A--E--Y--L--E--W--D--V--T--E--L--N--P--I--L--H-

----------------------------------------------------------------------------------------------------
-E--M--M--E--E--I--D--Y--D--H--D--G--T--V--S--L--E--E--W--I--Q--G--G--M--T--T--I--P--L--L--V--L--L--
GAAATGATGGAAGAAATTGACTATGATCATGATGGAACCGTGTCTCTGGAGGAATGGATTCAAGGAGGAATGACAACGATTCCACTTCTTGTGCTCCTGG
::::::::::::::::::::::::::::::::::::::.:: :::::::::::::::::::::::::::::::::::.::::::::::::::::::::.:
GAAATGATGGAAGAAATTGACTATGATCATGATGGAACTGTCTCTCTGGAGGAATGGATTCAAGGAGGAATGACAACAATTCCACTTCTTGTGCTCCTAG
-E--M--M--E--E--I--D--Y--D--H--D--G--T--V--S--L--E--E--W--I--Q--G--G--M--T--T--I--P--L--L--V--L--L--

----------><----------------------------------------------------------------------------------------
G--L--E--N--N--V--K--D--D--G--Q--H--V--W--R--L--K--H--F--N--K--P--A--Y--C--N--L--C--L--N--M--L--I--G
GCTTAGAAAATAACGTGAAGGATGATGGACAGCACGTGTGGCGACTGAAGCACTTTAACAAACCTGCCTATTGCAACCTTTGCCTGAACATGCTGATTGG
::::::::                                                                                            
GCTTAGAA--------------------------------------------------------------------------------------------
G--L--E---------------------------------------------------------------------------------------------

----------------------------><----------------------------------------------------------------------
--V--G--K--Q--G--L--C--C--S--F--C--K--Y--T--V--H--E--R--C--V--A--R--A--P--P--S--C--I--K--T--Y--V--K-
CGTGGGGAAGCAGGGCCTCTGCTGTTCCTTCTGCAAGTACACAGTCCATGAGCGCTGTGTGGCTCGAGCACCTCCCTCTTGCATCAAGACCTATGTGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------><---------------------------------------------------------------------------------
-S--K--R--N--T--D--V--M--H--H--Y--W--V--E--G--N--C--P--T--K--C--D--K--C--H--K--T--V--K--C--Y--Q--G--
TCCAAAAGGAACACTGATGTCATGCACCATTACTGGGTTGAAGGTAACTGCCCAACCAAGTGTGATAAGTGCCACAAAACTGTTAAATGTTACCAGGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------><----------------------------------------------------------------
L--T--G--L--H--C--V--W--C--Q--I--T--L--H--N--K--C--A--S--H--L--K--P--E--C--D--C--G--P--L--K--D--H--I
TGACAGGACTGCATTGTGTTTGGTGTCAGATCACACTGCATAATAAATGTGCTTCTCATCTAAAACCTGAATGTGACTGTGGACCTTTGAAGGACCATAT
                                   :::::::::::::::::::::::::::::::::::.::::::::.::::::::::::::::::::
-----------------------------------CTGCATAATAAATGTGCTTCTCATCTAAAACCTGAGTGTGACTGCGGACCTTTGAAGGACCATAT
------------------------------------L--H--N--K--C--A--S--H--L--K--P--E--C--D--C--G--P--L--K--D--H--I

---------------------------------><----------------------------------><-----------------------------
--L--P--P--T--T--I--C--P--V--V--L--Q--T--L--P--T--S--G--V--S--V--P--E--E--R--Q--S--T--V--K--K--E--K-
TTTACCACCCACAACAATCTGTCCAGTGGTACTGCAGACTCTGCCCACTTCAGGAGTTTCAGTTCCTGAGGAAAGACAATCAACAGTGAAAAAGGAAAAG
::::::::::::::::::::::::::::::::::                                                                  
TTTACCACCCACAACAATCTGTCCAGTGGTACTG------------------------------------------------------------------
--L--P--P--T--T--I--C--P--V--V--L-------------------------------------------------------------------

--------------------------------------------------------------------------------------><------------
-S--G--S--Q--Q--P--N--K--V--I--D--K--N--K--M--Q--R--A--N--S--V--T--V--D--G--Q--G--L--Q--V--T--P--V--
AGTGGTTCCCAGCAGCCAAACAAAGTGATTGACAAGAATAAAATGCAAAGAGCCAACTCTGTTACTGTAGATGGACAAGGCCTGCAGGTCACTCCTGTGC
      ::::::::: .:::::::::::.:::::::::::::::::::::.:::::::::::::::::.::::::::::::.:.:::   :::::::: :
------TCCCAGCAGGTAAACAAAGTGACTGACAAGAATAAAATGCAAAGGGCCAACTCTGTTACTGTGGATGGACAAGGCTTACAG---ACTCCTGTTC
-------S--Q--Q--V--N--K--V--T--D--K--N--K--M--Q--R--A--N--S--V--T--V--D--G--Q--G--L--Q-----T--P--V--

------------------------------------------------------------><--------------------------------------
P--G--T--H--P--L--L--V--F--V--N--P--K--S--G--G--K--Q--G--E--R--I--Y--R--K--F--Q--Y--L--L--N--P--R--Q
CTGGTACTCACCCACTTTTAGTTTTTGTGAACCCCAAAAGTGGTGGAAAACAAGGAGAACGAATTTACAGAAAATTCCAGTATCTATTAAATCCTCGTCA
::::::::::.::::::::::::::.::::::::::::::::::::.::.:::::::::                                         
CTGGTACTCATCCACTTTTAGTTTTCGTGAACCCCAAAAGTGGTGGGAAGCAAGGAGAA-----------------------------------------
P--G--T--H--P--L--L--V--F--V--N--P--K--S--G--G--K--Q--G--E------------------------------------------

-----------------------------------><---------------------------------------------------------------
--V--Y--S--L--S--G--N--G--P--M--P--G--L--N--F--F--R--D--V--P--D--F--R--V--L--A--C--G--G--D--G--T--V-
GGTTTACAGTCTTTCTGGAAATGGACCAATGCCAGGGTTAAACTTTTTCCGTGATGTTCCTGACTTCAGAGTGTTAGCCTGTGGTGGAGATGGAACCGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------><-----------------------------------------------------------------------------
-G--W--V--L--D--C--I--E--K--A--N--V--G--K--H--P--P--V--A--I--L--P--L--G--T--G--N--D--L--A--R--C--L--
GGCTGGGTTTTGGATTGCATAGAAAAGGCCAATGTAGGCAAGCATCCTCCAGTTGCGATTCTGCCTCTTGGGACTGGCAATGATCTAGCAAGATGCCTGC
                        :::::.::..::: :::.::::::::::: :: :::::::::::::::::.:::::::::::::::::::::::::
------------------------AAGGCTAACATAGTCAAACATCCTCCAGTGGCTATTCTGCCTCTTGGGACCGGCAATGATCTAGCAAGATGCCTGC
-------------------------K--A--N--I--V--K--H--P--P--V--A--I--L--P--L--G--T--G--N--D--L--A--R--C--L--

-----------><---------------------------------------------------------------------------------------
R--W--G--G--G--Y--E--G--E--N--L--M--K--I--L--K--D--I--E--N--S--T--E--I--M--L--D--R--W--K--F--E--V--I
GATGGGGAGGAGGTTACGAAGGTGAGAATCTGATGAAAATTCTAAAAGACATTGAAAACAGCACAGAAATCATGTTGGACAGGTGGAAGTTTGAAGTCAT
:::::::::::   ::.:::::::::::::::::::::::..::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GATGGGGAGGA---TATGAAGGTGAGAATCTGATGAAAATCTTAAAAGACATTGAAAACAGCACAGAAATCATGTTGGACAGGTGGAAGTTTGAAGTCAT
R--W--G--G-----Y--E--G--E--N--L--M--K--I--L--K--D--I--E--N--S--T--E--I--M--L--D--R--W--K--F--E--V--I

------------------------------------------------------------------------><--------------------------
--P--N--D--K--D--E--K--G--D--P--V--P--Y--S--I--I--N--N--Y--F--S--I--G--V--D--A--S--I--A--H--R--F--H-
ACCTAATGACAAAGATGAGAAAGGAGACCCAGTGCCTTACAGTATCATCAATAATTACTTTTCCATTGGCGTGGATGCCTCCATTGCACACAGATTCCAC
:::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::                           
ACCTAATGACAAAGATGAGAAGGGAGACCCAGTGCCTTACAGTATCATCAATAATTACTTTTCCATTGGCGTG---------------------------
--P--N--D--K--D--E--K--G--D--P--V--P--Y--S--I--I--N--N--Y--F--S--I--G--V----------------------------

-------------------------------------><-------------------------------------------------------------
-I--M--R--E--K--H--P--E--K--F--N--S--R--M--K--N--K--F--W--Y--F--E--F--G--T--S--E--T--F--S--A--T--C--
ATCATGAGAGAAAAACACCCAGAGAAATTCAACAGTAGAATGAAGAACAAATTTTGGTATTTTGAGTTTGGCACATCTGAAACTTTCTCAGCCACCTGCA
                                       :::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::
---------------------------------------ATGAAGAACAAATT-TGGTATTTTGAGTTTGGCACATCTGAAACTTTCTCAGCCACCTGCA
----------------------------------------M--K--N--K--F--W--Y--F--E--F--G--T--S--E--T--F--S--A--T--C--

-------------------------------><-------------------------------------------------------------------
K--K--L--H--E--S--V--E--I--E--C--D--G--V--Q--I--D--L--I--N--I--S--L--E--G--I--A--I--L--N--I--P--S--M
AGAAGCTACATGAATCTGTAGAAATAGAATGTGATGGAGTACAGATAGATTTAATAAACATCTCTCTGGAAGGAATTGCTATTTTGAATATACCAAGCAT
:::::::::::::::::::.::::::::::::::::::::.::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::
AGAAGCTACATGAATCTGTGGAAATAGAATGTGATGGAGTGCAGATTGATTTAATAAACATCTCTCTGGAAGGAATTGCTATTTTGAATATACCAAGCAT
K--K--L--H--E--S--V--E--I--E--C--D--G--V--Q--I--D--L--I--N--I--S--L--E--G--I--A--I--L--N--I--P--S--M

----------------------------------------------------------------------------------------------------
--H--G--G--S--N--L--W--G--E--S--K--K--R--R--S--H--R--R--I--E--K--K--G--S--D--K--R--T--T--V--T--D--A-
GCATGGAGGATCCAATCTTTGGGGAGAGTCTAAGAAAAGACGAAGCCATCGACGAATAGAGAAAAAAGGGTCTGACAAAAGGACCACCGTCACAGATGCC
:::.:::::.::.::::::::::::::.:::::.::.::::::::::::::  :::: :::::::::::.::::: :::::::::::  :::::::::::
GCACGGAGGGTCTAATCTTTGGGGAGAATCTAAAAAGAGACGAAGCCATCGCAGAATTGAGAAAAAAGGATCTGAAAAAAGGACCACACTCACAGATGCC
--H--G--G--S--N--L--W--G--E--S--K--K--R--R--S--H--R--R--I--E--K--K--G--S--E--K--R--T--T--L--T--D--A-

---------------------------><-----------------------------------------------------------------------
-K--E--L--K--F--A--S--Q--D--L--S--D--Q--L--L--E--V--V--G--L--E--G--A--M--E--M--G--Q--I--Y--T--G--L--
AAAGAGTTGAAGTTTGCAAGTCAAGATCTCAGTGACCAGCTGCTGGAGGTGGTCGGCTTGGAAGGAGCCATGGAGATGGGGCAAATATACACAGGCCTGA
:::::::::::::::::::::      :: :::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::.:::
AAAGAGTTGAAGTTTGCAAGT------CTGAGTGATCAGCTGCTGGAGGTGGTTGGCTTGGAAGGAGCCATGGAGATGGGGCAAATATACACAGGCTTGA
-K--E--L--K--F--A--S--------L--S--D--Q--L--L--E--V--V--G--L--E--G--A--M--E--M--G--Q--I--Y--T--G--L--

------------------------------------------------><--------------------------------------------------
K--S--A--G--R--R--L--A--Q--C--S--C--V--V--I--R--T--S--K--S--L--P--M--Q--I--D--G--E--P--W--M--Q--T--P
AAAGTGCTGGCCGGCGGCTGGCTCAGTGCTCCTGCGTGGTCATCAGGACGAGCAAGTCTCTGCCAATGCAAATTGATGGGGAGCCATGGATGCAGACCCC
:::::::::: :::::::::::::::::::::: .:::::.:::   :: ::::::::::::::::::::.::.::::::::.::.::::::::::::::
AAAGTGCTGGGCGGCGGCTGGCTCAGTGCTCCTCTGTGGTTATC---ACTAGCAAGTCTCTGCCAATGCAGATCGATGGGGAACCGTGGATGCAGACCCC
K--S--A--G--R--R--L--A--Q--C--S--S--V--V--I-----T--S--K--S--L--P--M--Q--I--D--G--E--P--W--M--Q--T--P

---------><-----------------------------------------------------------------------------------------
--C--T--I--K--I--T--H--K--N--Q--A--P--M--L--M--G--P--P--P--K--T--G--L--F--C--S--L--V--K--R--T--R--N-
ATGCACAATAAAAATTACACACAAGAACCAAGCCCCAATGCTGATGGGCCCGCCTCCAAAAACCGGTTTATTCTGCTCCCTCGTCAAAAGGACAAGAAAC
:::::::::::::::::.:::::::::.::::::::::::::::::::::: ::::::::::: :: ::.::::::::.:::::::::::.:::::::::
ATGCACAATAAAAATTATACACAAGAATCAAGCCCCAATGCTGATGGGCCCTCCTCCAAAAACGGGGTTGTTCTGCTCTCTCGTCAAAAGAACAAGAAAC
--C--T--I--K--I--I--H--K--N--Q--A--P--M--L--M--G--P--P--P--K--T--G--L--F--C--S--L--V--K--R--T--R--N-

---------------
-R--S--K--E--*-
CGAAGCAAGGAATAA
:::::::::::::::
CGAAGCAAGGAATAA
-R--S--K--E--*-

Pig Consensus Sequence

>BGISUST0000899870
------------------------------------------------------------------------TCTACAAAGAAATTAAAAGATGTTCTTG
AAGAATTCCATGGTAATGGTGTGCTTGCAAAGTATAATCCTGAAGGG-----------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------CTGAGAATGAATAAAGGGGCCATCACCCCTCCACGTACTTCTCCAGCAAATTCGTGTTCCCCCGAAGTGATCCATC
TGAAGGACATTGTCTGCTACCTGTCTCTCCTTGAAAGAGGAAGACCTGAGGATAAACTGGAG---ATGTTTCGCCTCTATGACACGGATGGAAATGGCTT
CCTGGACAGTTCGGAACTAGAAAATATCATCAGTCAGATGATGCATGTGGCAGAGTACCTTGAATGGGATGTCACTGAACTTAATCCAATCCTCCATGAA
ATGATGGAAGAAATTGACTATGATCATGATGGAACTGTCTCTCTGGAGGAATGGATTCAAGGAGGAATGACAACAATTCCACTTCTTGTGCTCCTAGGCT
TAGAA-----------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------CTGCATAATAAATGTGCTTCTCATCTAAAACCTGAGTGTGACTGCGGACCTTTGAAGGACCATATTTT
ACCACCCACAACAATCTGTCCAGTGGTACTG---------------------------------------------------------------------
---TCCCAGCAGGTAAACAAAGTGACTGACAAGAATAAAATGCAAAGGGCCAACTCTGTTACTGTGGATGGACAAGGCTTACAG---ACTCCTGTTCCTG
GTACTCATCCACTTTTAGTTTTCGTGAACCCCAAAAGTGGTGGGAAGCAAGGAGAA--------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------AAGGCTAACATAGTCAAACATCCTCCAGTGGCTATTCTGCCTCTTGGGACCGGCAATGATCTAGCAAGATGCCTGCGAT
GGGGAGGA---TATGAAGGTGAGAATCTGATGAAAATCTTAAAAGACATTGAAAACAGCACAGAAATCATGTTGGACAGGTGGAAGTTTGAAGTCATACC
TAATGACAAAGATGAGAAGGGAGACCCAGTGCCTTACAGTATCATCAATAATTACTTTTCCATTGGCGTG------------------------------
------------------------------------ATGAAGAACAAatGGTATTTTGAGTTTGGCACATCTGAAACTTTCTCAGCCACCTGCAAGAAGC
TACATGAATCTGTGGAAATAGAATGTGATGGAGTGCAGATTGATTTAATAAACATCTCTCTGGAAGGAATTGCTATTTTGAATATACCAAGCATGCACGG
AGGGTCTAATCTTTGGGGAGAATCTAAAAAGAGACGAAGCCATCGCAGAATTGAGAAAAAAGGATCTGAAAAAAGGACCACACTCACAGATGCCAAAGAG
TTGAAGTTTGCAAGT------CTGAGTGATCAGCTGCTGGAGGTGGTTGGCTTGGAAGGAGCCATGGAGATGGGGCAAATATACACAGGCTTGAAAAGTG
CTGGGCGGCGGCTGGCTCAGTGCTCCTCTGTGGTTATC---ACTAGCAAGTCTCTGCCAATGCAGATCGATGGGGAACCGTGGATGCAGACCCCATGCAC
AATAAAAATTATACACAAGAATCAAGCCCCAATGCTGATGGGCCCTCCTCCAAAAACGGGGTTGTTCTGCTCTCTCGTCAAAAGAACAAGAAACCGAAGC
AAGGAATAA


>BGISUSP0000899870
------------------------STKKLKDVLEEFHGNGVLAKYNPEG---------------------------------------------------
--------LRMNKGAITPPRTSPANSCSPEVIHLKDIVCYLSLLERGRPEDKLE-MFRLYDTDGNGFLDSSELENIISQMMHVAEYLEWDVTELNPILHE
MMEEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLE-----------------------------------------------------------------
--------------------------------------------LHNKCASHLKPECDCGPLKDHILPPTTICPVVL-----------------------
-SQQVNKVTDKNKMQRANSVTVDGQGLQ-TPVPGTHPLLVFVNPKSGGKQGE------------------------------------------------
-------KANIVKHPPVAILPLGTGNDLARCLRWGG-YEGENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGV----------
------------MKNKWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILNIPSMHGGSNLWGESKKRRSHRRIEKKGSEKRTTLTDAKE
LKFAS--LSDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCSSVVI-TSKSLPMQIDGEPWMQTPCTIKIIHKNQAPMLMGPPPKTGLFCSLVKRTRNRS
KE*