Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000136295 (click for geneview)
Transcript ID ENST00000258796(link to ensembl)
Symbol TTYH3
Localtion Chromosome:7:2444849:2477675:1 band: 7p22.3
Description tweety 3 [Source:RefSeq_peptide;Acc:NP_079526]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-C--G--R--P--G--G--G--R--R--V--P--E--A--R--A--P--G--Q--Q--G--S--P--A--Q--A--A--R--I--R--R--R--P--G--
TGCGGGCGGCCAGGCGGGGGTCGACGGGTCCCTGAAGCCCGCGCCCCGGGCCAGCAAGGGAGCCCCGCGCAGGCCGCGCGCATCCGGAGGCGGCCGGGCC
                                                                                                   :
---------------------------------------------------------------------------------------------------C
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--A--M--A--G--V--S--Y--A--A--P--W--W--V--S--L--L--H--R--L--P--H--F--D--L--S--W--E--A--T--S--S--Q--F
CCGCCATGGCCGGGGTCAGCTACGCGGCGCCCTGGTGGGTGAGCCTCCTGCACCGGCTGCCCCACTTCGACCTGAGCTGGGAGGCCACTAGCAGCCAGTT
:  :   : : ::: :::::::: ::::::::::::::::::::::::::::::::::::: :::::::::::: .:::::::.::::.:::::::::::
CGCCATGGCCGGGGCTCAGCTACTCGGCGCCCTGGTGGGTGAGCCTCCTGCACCGGCTGCCGCACTTCGACCTGCACTGGGAGACCACCAGCAGCCAGTT
P--P--W--P--G--L--S--Y--S--A--P--W--W--V--S--L--L--H--R--L--P--H--F--D--L--H--W--E--T--T--S--S--Q--F

---------------------------><-----------------------------------------------------------------------
--R--P--E--D--T--D--Y--Q--Q--A--L--L--L--L--G--A--A--A--L--A--C--L--A--L--D--L--L--F--L--L--F--Y--S-
CCGGCCCGAGGACACCGACTACCAGCAGGCCCTGCTGCTCCTGGGGGCCGCCGCCCTGGCCTGCCTCGCCCTGGACCTCCTCTTCCTGCTCTTCTACTCC
::::::::::::::: :::::::::::::: :::::::: ::::::::::: :: :::::::::::::::::::::::::::::::::::::::::::::
CCGGCCCGAGGACACGGACTACCAGCAGGCGCTGCTGCTGCTGGGGGCCGCGGCGCTGGCCTGCCTCGCCCTGGACCTCCTCTTCCTGCTCTTCTACTCC
--R--P--E--D--T--D--Y--Q--Q--A--L--L--L--L--G--A--A--A--L--A--C--L--A--L--D--L--L--F--L--L--F--Y--S-

-------------------------------------------------------------------------------------------------><-
-F--W--L--C--C--R--R--R--K--S--E--E--H--L--D--A--D--C--C--C--T--A--W--C--V--I--I--A--T--L--V--C--S--
TTCTGGCTGTGCTGCCGGCGGCGCAAGAGCGAGGAGCACCTGGACGCCGACTGCTGCTGCACGGCCTGGTGTGTCATCATCGCCACGCTGGTGTGCAGCG
:::::::::::::::::::: :::::.::::::::::::::::::::::::::::::::::: ::::::::.:::::::::::::: ::::: :::   :
TTCTGGCTGTGCTGCCGGCGCCGCAAAAGCGAGGAGCACCTGGACGCCGACTGCTGCTGCACCGCCTGGTGCGTCATCATCGCCACTCTGGTCTGC---G
-F--W--L--C--C--R--R--R--K--S--E--E--H--L--D--A--D--C--C--C--T--A--W--C--V--I--I--A--T--L--V--C-----

----------------------------------------------------------------------------------------------------
A--G--I--A--V--G--F--Y--G--N--G--E--T--S--D--G--I--H--R--A--T--Y--S--L--R--H--A--N--R--T--V--A--G--V
CCGGCATCGCAGTGGGATTCTACGGCAACGGGGAGACCAGTGATGGCATCCATAGGGCCACCTACTCGCTCCGCCACGCCAACCGCACGGTGGCCGGGGT
:::::::::: :::::::::::.:::::::::::.:: ::.::.::::::::: :::: ::::::::::::::::::::::::::.:::::::: :::::
CCGGCATCGCCGTGGGATTCTATGGCAACGGGGAAAC-AGCGACGGCATCCATCGGGCGACCTACTCGCTCCGCCACGCCAACCGTACGGTGGCGGGGGT
A--G--I--A--V--G--F--Y--G--N--G--E--T--S--D--G--I--H--R--A--T--Y--S--L--R--H--A--N--R--T--V--A--G--V

------------><--------------------------------------------------------------------------------------
--Q--D--R--V--W--D--T--A--V--G--L--N--H--T--A--E--P--S--L--Q--T--L--E--R--Q--L--A--G--R--P--E--P--L-
CCAGGACCGCGTGTGGGACACGGCGGTGGGGCTGAACCACACGGCGGAGCCCAGCCTGCAGACCCTGGAGCGGCAGCTGGCCGGGCGGCCCGAGCCCCTG
::::::::::::::::::.:: :: ..::  ::::::: ::::::::::::::::::::::: ::::::. :::::::::: .  ::::: :: ::.:::
CCAGGACCGCGTGTGGGATACCGCTACGGCCCTGAACCTCACGGCGGAGCCCAGCCTGCAGAGCCTGGAAAGGCAGCTGGCGACTCGGCCGGACCCTCTG
--Q--D--R--V--W--D--T--A--T--A--L--N--L--T--A--E--P--S--L--Q--S--L--E--R--Q--L--A--T--R--P--D--P--L-

----------------------------------------------------------------------------------------------------
-R--A--V--Q--R--L--Q--G--L--L--E--T--L--L--G--Y--T--A--A--I--P--F--W--R--N--T--A--V--S--L--E--V--L--
CGAGCCGTACAGAGGCTGCAGGGCCTGCTGGAGACGCTGCTGGGCTACACGGCCGCCATCCCCTTTTGGAGGAACACGGCGGTGTCGCTGGAGGTGCTGG
::.:: :: ::: :::::::.:::::::: .::::::::::::::::..:.::.:::::::: ::.::::::::: :.:: ::::: :::::::::::::
CGGGCGGTCCAGCGGCTGCAAGGCCTGCTCAAGACGCTGCTGGGCTATGCAGCTGCCATCCCGTTCTGGAGGAACCCAGCTGTGTCCCTGGAGGTGCTGG
-R--A--V--Q--R--L--Q--G--L--L--K--T--L--L--G--Y--A--A--A--I--P--F--W--R--N--P--A--V--S--L--E--V--L--

---------------------------------><-----------------------------------------------------------------
A--E--Q--V--D--L--Y--D--W--Y--R--W--L--G--Y--L--G--L--L--L--L--D--V--I--I--C--L--L--V--L--V--G--L--I
CGGAGCAGGTGGATCTCTACGACTGGTACAGGTGGCTGGGCTACCTGGGCCTGCTGCTGCTGGACGTCATCATCTGCCTCCTGGTGCTGGTTGGCCTCAT
:::::::::::::::::::.:::::::::   ::::::::::::::::::::::::::::: :::::...::::::.::.:::::.:::::.::::::::
CGGAGCAGGTGGATCTCTATGACTGGTAC---TGGCTGGGCTACCTGGGCCTGCTGCTGCTCGACGTTGCCATCTGTCTTCTGGTACTGGTCGGCCTCAT
A--E--Q--V--D--L--Y--D--W--Y-----W--L--G--Y--L--G--L--L--L--L--D--V--A--I--C--L--L--V--L--V--G--L--I

-----------------------------><---------------------------------------------------------------------
--R--S--S--K--G--I--L--V--G--V--C--L--L--G--V--L--A--L--V--I--S--W--G--A--L--G--L--E--L--A--V--S--V-
CCGCAGCTCCAAGGGCATCCTGGTGGGGGTCTGCCTGCTGGGAGTCCTGGCCCTGGTCATCAGCTGGGGCGCGCTGGGCTTGGAGCTGGCTGTGTCCGTG
:::::::::::::::::::.::      :::::::: ::::: ::::::::::::.:::::::::::::.:: :::::::::::::::::.:::::.:::
CCGCAGCTCCAAGGGCATCTTG------GTCTGCCTCCTGGGTGTCCTGGCCCTGATCATCAGCTGGGGTGCCCTGGGCTTGGAGCTGGCCGTGTCTGTG
--R--S--S--K--G--I--L--------V--C--L--L--G--V--L--A--L--I--I--S--W--G--A--L--G--L--E--L--A--V--S--V-

--><--------------------------------------------------------------------------><--------------------
-G--S--S--D--F--C--V--D--P--D--A--Y--V--T--K--M--V--E--E--Y--S--V--L--S--G--D--I--L--Q--Y--Y--L--A--
GGCTCCAGCGACTTCTGTGTGGACCCTGACGCCTACGTGACCAAAATGGTGGAGGAGTACTCGGTGCTGAGTGGGGACATCCTGCAGTACTACCTGGCCT
:::::::::::::::::.::::::::.:::.::::.:::::::..::::::::::::.:::::::::::::.:::   ::::::::::::::: ::.:::
GGCTCCAGCGACTTCTGCGTGGACCCCGACACCTATGTGACCAGGATGGTGGAGGAGCACTCGGTGCTGAGCGGG---ATCCTGCAGTACTACGTGACCT
-G--S--S--D--F--C--V--D--P--D--T--Y--V--T--R--M--V--E--E--H--S--V--L--S--G-----I--L--Q--Y--Y--V--T--

----------------------------------><----------------------------------------------------------------
C--S--P--R--A--A--N--P--F--Q--Q--K--L--S--G--S--H--K--A--L--V--E--M--Q--D--V--V--A--E--L--L--R--T--V
GCTCGCCCCGCGCCGCCAACCCCTTCCAGCAGAAGCTGTCGGGCAGCCACAAGGCACTGGTGGAGATGCAGGATGTCGTGGCTGAGCTTCTGAGGACCGT
::::::::...:::.:::::::::::::::::                                                                    
GCTCGCCCTATGCCACCAACCCCTTCCAGCAG--------------------------------------------------------------------
C--S--P--Y--A--T--N--P--F--Q--Q---------------------------------------------------------------------

---------------------------><-----------------------------------------------------------------------
--P--W--E--Q--P--A--T--K--D--P--L--L--R--V--Q--E--V--L--N--G--T--E--V--N--L--Q--H--L--T--A--L--V--D-
CCCCTGGGAGCAGCCGGCCACTAAGGACCCCCTCCTCCGCGTCCAGGAGGTGCTGAATGGCACGGAGGTGAACCTGCAGCACCTCACCGCCCTGGTGGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------><------------------------------------------------------------------------------
-C--R--S--L--H--L--D--Y--V--Q--A--L--T--G--F--C--Y--D--G--V--E--G--L--I--Y--L--A--L--F--S--F--V--T--
TGCCGCAGCCTGCATCTGGACTACGTGCAAGCGCTGACCGGCTTCTGCTATGACGGCGTGGAGGGCCTCATCTACCTGGCCCTCTTCTCCTTCGTCACAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------><-----------------------------------------
A--L--M--F--S--S--I--V--C--S--V--P--H--T--W--Q--Q--K--R--G--P--D--E--D--G--E--E--E--A--A--P--G--P--R
CCCTCATGTTCAGCTCCATCGTCTGCAGCGTCCCGCACACCTGGCAGCAAAAGAGAGGCCCTGATGAGGACGGGGAGGAGGAGGCCGCTCCAGGGCCGCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--A--H--D--S--L--Y--R--V--H--M--P--S--L--Y--S--C--G--S--S--Y--G--S--E--T--S--I--P--A--A--A--H--T-
GCAGGCGCACGACAGCCTCTACCGCGTCCACATGCCCAGCCTGTACAGCTGTGGCAGCAGCTACGGCAGTGAGACCAGCATCCCGGCCGCGGCCCACACC
                                                       ::::::::::::::.:::::::::::::::::::: ::::::::.
-------------------------------------------------------AGCAGCTACGGCAGCGAGACCAGCATCCCGGCCGCCGCCCACACT
--------------------------------------------------------S--S--Y--G--S--E--T--S--I--P--A--A--A--H--T-

-------------------------------><-------------------------------------------------------------------
-V--S--N--A--P--V--T--E--Y--M--S--Q--N--A--N--F--Q--N--P--R--C--E--N--T--P--L--I--G--R--E--S--P--P--
GTCAGCAACGCCCCGGTCACTGAGTACATGAGCCAGAACGCTAATTTCCAGAACCCCCGCTGTGAGAACACCCCACTCATTGGGCGCGAGTCCCCGCCGC
:::::::::::::::::::::::::::                                                                         
GTCAGCAACGCCCCGGTCACTGAGTAC-------------------------------------------------------------------------
-V--S--N--A--P--V--T--E--Y--------------------------------------------------------------------------

-------><--------------------------------------------------------------------
P--S--Y--T--S--S--M--R--A--K--Y--L--A--T--S--Q--P--R--P--D--S--S--G--S--H--*-
CCTCATACACCTCCAGCATGAGAGCCAAATACCTCGCCACGAGCCAGCCTCGCCCTGACTCCAGCGGCAGCCACTAG
                                                                             
-----------------------------------------------------------------------------
-----------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000883172
---------------------------------------------------------------------------------------------------C
CGCCATGGCCGGGGCTCAGCTACTCGGCGCCCTGGTGGGTGAGCCTCCTGCACCGGCTGCCGCACTTCGACCTGCACTGGGAGACCACCAGCAGCCAGTT
CCGGCCCGAGGACACGGACTACCAGCAGGCGCTGCTGCTGCTGGGGGCCGCGGCGCTGGCCTGCCTCGCCCTGGACCTCCTCTTCCTGCTCTTCTACTCC
TTCTGGCTGTGCTGCCGGCGCCGCAAAAGCGAGGAGCACCTGGACGCCGACTGCTGCTGCACCGCCTGGTGCGTCATCATCGCCACTCTGGTCTGC---G
CCGGCATCGCCGTGGGATTCTATGGCAACGGGGAaaGCGACGGCATCCATCGGGCGACCTACTCGCTCCGCCACGCCAACCGTACGGTGGCGGGGGTCCA
GGACCGCGTGTGGGATACCGCTACGGCCCTGAACCTCACGGCGGAGCCCAGCCTGCAGAGCCTGGAAAGGCAGCTGGCGACTCGGCCGGACCCTCTGCGG
GCGGTCCAGCGGCTGCAAGGCCTGCTCAAGACGCTGCTGGGCTATGCAGCTGCCATCCCGTTCTGGAGGAACCCAGCTGTGTCCCTGGAGGTGCTGGCGG
AGCAGGTGGATCTCTATGACTGGTAC---TGGCTGGGCTACCTGGGCCTGCTGCTGCTCGACGTTGCCATCTGTCTTCTGGTACTGGTCGGCCTCATCCG
CAGCTCCAAGGGCATCTTG------GTCTGCCTCCTGGGTGTCCTGGCCCTGATCATCAGCTGGGGTGCCCTGGGCTTGGAGCTGGCCGTGTCTGTGGGC
TCCAGCGACTTCTGCGTGGACCCCGACACCTATGTGACCAGGATGGTGGAGGAGCACTCGGTGCTGAGCGGG---ATCCTGCAGTACTACGTGACCTGCT
CGCCCTATGCCACCAACCCCTTCCAGCAG-----------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------AGCAGCTACGGCAGCGAGACCAGCATCCCGGCCGCCGCCCACACTGTC
AGCAACGCCCCGGTCACTGAGTAC----------------------------------------------------------------------------
--------------------------------------------------------------------------


>BGISUSP0000883172
---------------------------------PPWPGLSYSAPWWVSLLHRLPHFDLHWETTSSQFRPEDTDYQQALLLLGAAALACLALDLLFLLFYS
FWLCCRRRKSEEHLDADCCCTAWCVIIATLVC-AGIAVGFYGNGESDGIHRATYSLRHANRTVAGVQDRVWDTATALNLTAEPSLQSLERQLATRPDPLR
AVQRLQGLLKTLLGYAAAIPFWRNPAVSLEVLAEQVDLYDWY-WLGYLGLLLLDVAICLLVLVGLIRSSKGIL--VCLLGVLALIISWGALGLELAVSVG
SSDFCVDPDTYVTRMVEEHSVLSG-ILQYYVTCSPYATNPFQQ---------------------------------------------------------
------------------------------------------------------------------------------------SSYGSETSIPAAAHTV
SNAPVTEY--------------------------------------------------