Sequences
EST Library Info
amn1Amnion
csp1Spleen - RNA from China
ecc1Foetus 50 days, cortex cerebri
jca2Joint capsule
jej1Small intestine, jejunum
med2Mediastinum
nco1Newborn 115 days, colon
pigca4Unavailable
relu1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000136986 (click for geneview)
Transcript ID ENST00000259512(link to ensembl)
Symbol DERL1
Localtion Chromosome:8:124094769:124123722:-1 band: 8q24.13
Description Derlin-1 (Degradation in endoplasmic reticulum protein 1) (Der1-like protein 1) (DERtrin 1). [Source:Uniprot/SWISSPROT;Acc:Q9BUN8]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--D--I--G--D--W--F--R--S--I--P--A--I--T--R--Y--W--F--A--A--T--V--A--V--P--L--V--G--K--L--G--L--
ATGTCGGACATCGGAGACTGGTTCAGGAGCATCCCGGCGATCACGCGCTATTGGTTCGCCGCCACCGTCGCCGTGCCCTTGGTCGGCAAACTCGGCCTCA
::::::::::::::.::::::::::::::.:::::::: :::::::::::::::::::::::::::::.:: ::::::::.::::::::::::::.::::
ATGTCGGACATCGGGGACTGGTTCAGGAGTATCCCGGCTATCACGCGCTATTGGTTCGCCGCCACCGTTGCAGTGCCCTTAGTCGGCAAACTCGGTCTCA
-M--S--D--I--G--D--W--F--R--S--I--P--A--I--T--R--Y--W--F--A--A--T--V--A--V--P--L--V--G--K--L--G--L--

----------------------------------------------------><----------------------------------------------
I--S--P--A--Y--L--F--L--W--P--E--A--F--L--Y--R--F--Q--I--W--R--P--I--T--A--T--F--Y--F--P--V--G--P--G
TCAGCCCGGCCTACCTCTTCCTCTGGCCCGAAGCCTTCCTTTATCGCTTTCAGATTTGGAGGCCAATCACTGCCACCTTTTATTTCCCTGTGGGTCCAGG
:::::::::::::..:::::::::::::.::::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::.:::::::::::
TCAGCCCGGCCTATTTCTTCCTCTGGCCTGAAGCCTTCCTTTATCGCTTCCAGATTTGGAGGCCGATCACTGCCACCTTTTATTTCCCCGTGGGTCCAGG
I--S--P--A--Y--F--F--L--W--P--E--A--F--L--Y--R--F--Q--I--W--R--P--I--T--A--T--F--Y--F--P--V--G--P--G

----------------------------------------------------------------><----------------------------------
--T--G--F--L--Y--L--V--N--L--Y--F--L--Y--Q--Y--S--T--R--L--E--T--G--A--F--D--G--R--P--A--D--Y--L--F-
AACTGGATTTCTTTATTTGGTCAATTTATATTTCTTATATCAGTATTCTACGCGACTTGAAACAGGAGCTTTTGATGGGAGGCCAGCAGACTATTTATTC
::::::::::::::::::::::::::::::.::::::::::::::::::::.:::::.::::::   :::::.:::::::::::.:: ::::::::::::
AACTGGATTTCTTTATTTGGTCAATTTATACTTCTTATATCAGTATTCTACACGACTCGAAACA---GCTTTCGATGGGAGGCCGGCCGACTATTTATTC
--T--G--F--L--Y--L--V--N--L--Y--F--L--Y--Q--Y--S--T--R--L--E--T-----A--F--D--G--R--P--A--D--Y--L--F-

-----------------------------><-------------------------><------------------------------------------
-M--L--L--F--N--W--I--C--I--V--I--T--G--L--A--M--D--M--Q--L--L--M--I--P--L--I--M--S--V--L--Y--V--W--
ATGCTCCTCTTTAACTGGATTTGCATCGTGATTACTGGCTTAGCAATGGATATGCAGTTGCTGATGATTCCTCTGATCATGTCAGTACTTTATGTCTGGG
::::::::::::::::::::::::::.:::                           :::::::::::.:::::::::::::::::.:::::.:::::::
ATGCTCCTCTTTAACTGGATTTGCATTGTG---------------------------TTGCTGATGATCCCTCTGATCATGTCAGTGCTTTACGTCTGGG
-M--L--L--F--N--W--I--C--I--V-----------------------------L--L--M--I--P--L--I--M--S--V--L--Y--V--W--

----------------------------------------------------><----------------------------------------------
A--Q--L--N--R--D--M--I--V--S--F--W--F--G--T--R--F--K--A--C--Y--L--P--W--V--I--L--G--F--N--Y--I--I--G
CCCAGCTGAACAGAGACATGATTGTATCATTTTGGTTTGGAACACGATTTAAGGCCTGCTATTTACCCTGGGTTATCCTTGGATTCAACTATATCATCGG
::::::::::::::::::::::::::::.::: ::::::::::: :::::::::::::.::::::::.::::::::::::::::::::::::::::::::
CCCAGCTGAACAGAGACATGATTGTATCGTTTGGGTTTGGAACAAGATTTAAGGCCTGTTATTTACCTTGGGTTATCCTTGGATTCAACTATATCATCGG
A--Q--L--N--R--D--M--I--V--S--F--G--F--G--T--R--F--K--A--C--Y--L--P--W--V--I--L--G--F--N--Y--I--I--G

-----><---------------------------------------------------------------------------------------------
--G--S--V--I--N--E--L--I--G--N--L--V--G--H--L--Y--F--F--L--M--F--R--Y--P--M--D--L--G--G--R--N--F--L-
AGGCTCGGTAATCAATGAGCTTATTGGAAATCTGGTTGGACATCTTTATTTTTTCCTAATGTTCAGATACCCAATGGACTTGGGAGGAAGAAATTTTCTA
::::   :: :::::.::::::::.:::::::: ::::::::.::::::::.::::: :::::::::::::::::::::::::::::::::::.:::::.
AGGC---GTCATCAACGAGCTTATCGGAAATCTCGTTGGACACCTTTATTTCTTCCTCATGTTCAGATACCCAATGGACTTGGGAGGAAGAAACTTTCTG
--G-----V--I--N--E--L--I--G--N--L--V--G--H--L--Y--F--F--L--M--F--R--Y--P--M--D--L--G--G--R--N--F--L-

----------------><----------------------------------------------------------------------------------
-S--T--P--Q--F--L--Y--R--W--L--P--S--R--R--G--G--V--S--G--F--G--V--P--P--A--S--M--R--R--A--A--D--Q--
TCCACACCTCAGTTTTTGTACCGCTGGCTGCCCAGTAGGAGAGGAGGAGTATCAGGATTTGGTGTGCCCCCTGCTAGCATGAGGCGAGCTGCTGATCAGA
:::::.:::::::::   :::::::::::::::::.:::::::::::.::.:::::.:::::.:::::::::::::::::: :::::::.::.:::::::
TCCACGCCTCAGTTT---TACCGCTGGCTGCCCAGCAGGAGAGGAGGGGTGTCAGGGTTTGGCGTGCCCCCTGCTAGCATGCGGCGAGCCGCCGATCAGA
-S--T--P--Q--F-----Y--R--W--L--P--S--R--R--G--G--V--S--G--F--G--V--P--P--A--S--M--R--R--A--A--D--Q--

------------------------------------------------------->
N--G--G--G--G--R--H--N--W--G--Q--G--F--R--L--G--D--Q--*-
ATGGCGGAGGCGGGAGACACAACTGGGGCCAGGGCTTTCGACTTGGAGACCAGTGA
:.::::: :::::::::::::::::::: ::::::::::: ::.::.:::::::::
ACGGCGGCGGCGGGAGACACAACTGGGGACAGGGCTTTCGCCTCGGGGACCAGTGA
N--G--G--G--G--R--H--N--W--G--Q--G--F--R--L--G--D--Q--*-

Pig Consensus Sequence

>BGISUST0000881013
ATGTCGGACATCGGGGACTGGTTCAGGAGTATCCCGGCTATCACGCGCTATTGGTTCGCCGCCACCGTTGCAGTGCCCTTAGTCGGCAAACTCGGTCTCA
TCAGCCCGGCCTATTTCTTCCTCTGGCCTGAAGCCTTCCTTTATCGCTTCCAGATTTGGAGGCCGATCACTGCCACCTTTTATTTCCCCGTGGGTCCAGG
AACTGGATTTCTTTATTTGGTCAATTTATACTTCTTATATCAGTATTCTACACGACTCGAAACA---GCTTTCGATGGGAGGCCGGCCGACTATTTATTC
ATGCTCCTCTTTAACTGGATTTGCATTGTG---------------------------TTGCTGATGATCCCTCTGATCATGTCAGTGCTTTACGTCTGGG
CCCAGCTGAACAGAGACATGATTGTATCGTTTGGGTTTGGAACAAGATTTAAGGCCTGTTATTTACCTTGGGTTATCCTTGGATTCAACTATATCATCGG
AGGC---GTCATCAACGAGCTTATCGGAAATCTCGTTGGACACCTTTATTTCTTCCTCATGTTCAGATACCCAATGGACTTGGGAGGAAGAAACTTTCTG
TCCACGCCTCAGTTT---TACCGCTGGCTGCCCAGCAGGAGAGGAGGGGTGTCAGGGTTTGGCGTGCCCCCTGCTAGCATGCGGCGAGCCGCCGATCAGA
ACGGCGGCGGCGGGAGACACAACTGGGGACAGGGCTTTCGCCTCGGGGACCAGTGA


>BGISUSP0000881013
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYFFLWPEAFLYRFQIWRPITATFYFPVGPGTGFLYLVNLYFLYQYSTRLET-AFDGRPADYLF
MLLFNWICIV---------LLMIPLIMSVLYVWAQLNRDMIVSFGFGTRFKACYLPWVILGFNYIIGG-VINELIGNLVGHLYFFLMFRYPMDLGGRNFL
STPQF-YRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ*