Sequences
EST Library Info
nep2Newborn 115 days, epidermis
Clusters
Oligos
SNPs

Gene ID ENSG00000137197 (click for geneview)
Transcript ID ENST00000259726(link to ensembl)
Symbol CDSN
Localtion Chromosome:6:31191340:31196189:-1 band: 6p21.33
Description Corneodesmosin precursor (S protein). [Source:Uniprot/SWISSPROT;Acc:Q15517]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------------------><--------------
-M--G--S--S--R--A--P--W--M--G--R--V--G--G--H--G--M--M--A--L--L--L--A--G--L--L--L--P--G--T--L--A--K--
ATGGGCTCGTCTCGGGCACCCTGGATGGGGCGTGTGGGTGGGCACGGGATGATGGCACTGCTGCTGGCTGGTCTCCTCCTGCCAGGGACCTTGGCTAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--I--G--T--F--S--D--P--C--K--D--P--T--R--I--T--S--P--N--D--P--C--L--T--G--K--G--D--S--S--G--F--S--S
GCATTGGCACCTTCTCAGACCCTTGTAAGGACCCCACGCGTATCACCTCCCCTAACGACCCCTGCCTCACTGGGAAGGGTGACTCCAGCGGTTTCAGTAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Y--S--G--S--S--S--S--G--S--S--I--S--S--A--R--S--S--G--G--G--S--S--G--S--S--S--G--S--S--I--A--Q--G-
CTACAGTGGCTCCAGCAGTTCTGGCAGCTCCATTTCCAGTGCCAGAAGCTCTGGTGGTGGCTCCAGTGGTAGCTCCAGCGGATCCAGCATTGCCCAGGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--S--A--G--S--F--K--P--G--T--G--Y--S--Q--V--S--Y--S--S--G--S--G--S--S--L--Q--G--A--S--G--S--S--Q--
GGTTCTGCAGGATCTTTTAAGCCAGGAACGGGGTATTCCCAGGTCAGCTACTCCTCCGGATCTGGCTCTAGTCTACAAGGTGCATCCGGTTCCTCCCAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--G--S--S--S--S--H--S--G--N--S--G--S--H--S--G--S--S--S--S--H--S--S--S--S--S--S--F--Q--F--S--S--S--S
TGGGGAGCAGCAGCTCTCACTCGGGAAACAGCGGCTCTCACTCGGGAAGCAGCAGCTCTCATTCGAGCAGCAGCAGCAGCTTTCAGTTCAGCAGCAGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--F--Q--V--G--N--G--S--A--L--P--T--N--D--N--S--Y--R--G--I--L--N--P--S--Q--P--G--Q--S--S--S--S--S--Q-
CTTCCAAGTAGGGAATGGCTCTGCTCTGCCAACCAATGACAACTCTTACCGCGGAATACTAAACCCTTCCCAGCCTGGACAAAGCTCTTCCTCTTCCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--F--G--V--S--S--S--G--Q--S--V--S--S--N--Q--R--P--C--S--S--D--I--P--D--S--P--C--S--G--G--P--I--V--
ACCTTTGGGGTATCCAGCAGTGGCCAAAGCGTCAGCTCCAACCAGCGTCCCTGTAGTTCGGACATCCCCGACTCTCCCTGCAGTGGAGGGCCCATCGTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--H--S--G--P--Y--I--P--S--S--H--S--V--S--G--G--Q--R--P--V--V--V--V--V--D--Q--H--G--S--G--A--P--G--V
CGCACTCCGGCCCCTACATCCCCAGCTCCCACTCTGTGTCAGGGGGTCAGAGGCCTGTGGTGGTGGTGGTGGACCAGCACGGTTCTGGTGCCCCTGGAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--Q--G--P--P--C--S--N--G--G--L--P--G--K--P--C--P--P--I--T--S--V--D--K--S--Y--G--G--Y--E--V--V--G-
GGTTCAAGGTCCCCCCTGTAGCAATGGTGGCCTTCCAGGCAAGCCCTGTCCCCCAATCACCTCTGTAGACAAATCCTATGGTGGCTACGAGGTGGTGGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--S--S--D--S--Y--L--V--P--G--M--T--Y--S--K--G--K--I--Y--P--V--G--Y--F--T--K--E--N--P--V--K--G--S--
GGCTCCTCTGACAGTTATCTGGTTCCAGGCATGACCTACAGTAAGGGTAAAATCTACCCTGTGGGCTACTTCACCAAAGAGAACCCTGTGAAAGGCTCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--G--V--P--S--F--A--A--G--P--P--I--S--E--G--K--Y--F--S--S--N--P--I--I--P--S--Q--S--A--A--S--S--A--I
CAGGGGTCCCTTCCTTTGCAGCTGGGCCCCCCATCTCTGAGGGCAAATACTTCTCCAGCAACCCCATCATCCCCAGCCAGTCGGCAGCTTCCTCGGCCAT
                                                                             ::::::: ::: :::::::::::
-----------------------------------------------------------------------------CAGTCGGGAGCATCCTCGGCCAT
------------------------------------------------------------------------------Q--S--G--A--S--S--A--M

----------------------------------------------------------------------------------------------------
--A--F--Q--P--V--G--T--G--G--V--Q--L--C--G--G--G--S--T--G--S--K--G--P--C--S--P--S--S--S--R--V--P--S-
TGCATTCCAGCCAGTGGGGACTGGTGGGGTCCAGCTCTGTGGAGGCGGCTCCACGGGCTCCAAGGGACCCTGCTCTCCCTCCAGTTCTCGAGTCCCCAGC
 :..::::::::::::::  :::::::::::::::.:::::: : .:::::.:  :::::.::.::.::::::::.:.::::.::::: :::::: ::::
GGTGTTCCAGCCAGTGGGCTCTGGTGGGGTCCAGCCCTGTGGCGTTGGCTCTAGCGGCTCTAAAGGGCCCTGCTCCCTCTCCGGTTCTGGAGTCCACAGC
--V--F--Q--P--V--G--S--G--G--V--Q--P--C--G--V--G--S--S--G--S--K--G--P--C--S--L--S--G--S--G--V--H--S-

----------------------------------------------------------------------------------------------------
-S--S--S--I--S--S--S--S--G--L--P--Y--H--P--C--G--S--A--S--Q--S--P--C--S--P--P--G--T--G--S--F--S--S--
AGTTCTAGCATTTCCAGCAGCTCCGGTTTACCCTACCATCCCTGCGGCAGTGCTTCCCAGAGCCCCTGCTCCCCACCAGGCACCGGCTCCTTCAGCAGCA
:::::::::::::: :::::.::.::::.:.::: :::::::::.:::: ::.:::::::.: :::::::: ::.:: :::::::::::.:::::..:::
AGTTCTAGCATTTCAAGCAGTTCTGGTTCATCCTTCCATCCCTGTGGCACTGTTTCCCAGGGGCCCTGCTCGCCGCCTGGCACCGGCTCTTTCAGTGGCA
-S--S--S--I--S--S--S--S--G--S--S--F--H--P--C--G--T--V--S--Q--G--P--C--S--P--P--G--T--G--S--F--S--G--

----------------------------------------------------------------------------------------------------
S--S--S--S--Q--S--S--G--K--I--I--L--Q--P--C--G--S--K--S--S--S--S--G--H--P--C--M--S--V--S--S--L--T--L
GCTCCAGTTCCCAATCCAGTGGCAAAATCATCCTTCAGCCTTGTGGCAGCAAGTCCAGCTCTTCTGGTCACCCTTGCATGTCTGTCTCCTCCTTGACACT
:::::::.::  ::::..::::::::::::::::::::::.::::::::::::::::::::::::::.::::::::::: :::::::::::::.::: .:
GCTCCAGCTCGAAATCTGGTGGCAAAATCATCCTTCAGCCCTGTGGCAGCAAGTCCAGCTCTTCTGGCCACCCTTGCATTTCTGTCTCCTCCTCGACCTT
S--S--S--S--K--S--G--G--K--I--I--L--Q--P--C--G--S--K--S--S--S--S--G--H--P--C--I--S--V--S--S--S--T--L

----------------------------------------------------------------------------------------------------
--T--G--G--P--D--G--S--P--H--P--D--P--S--A--G--A--K--P--C--G--S--S--S--A--G--K--I--P--C--R--S--I--R-
GACTGGGGGCCCCGATGGCTCTCCCCATCCTGATCCCTCCGCTGGTGCCAAGCCCTGTGGCTCCAGCAGTGCTGGAAAGATCCCCTGCCGCTCCATCCGG
:: .:::::.:: :::::::::::::: ::::::::::: ::::::::::::::::::::.:::.::::. :::::::::::::::::::::::::::::
GAGCGGGGGTCCAGATGGCTCTCCCCAACCTGATCCCTCAGCTGGTGCCAAGCCCTGTGGTTCCGGCAGCTCTGGAAAGATCCCCTGCCGCTCCATCCGG
--S--G--G--P--D--G--S--P--Q--P--D--P--S--A--G--A--K--P--C--G--S--G--S--S--G--K--I--P--C--R--S--I--R-

----------------------------------------------------------------------------------------->
-D--I--L--A--Q--V--K--P--L--G--P--Q--L--A--D--P--E--V--F--L--P--Q--G--E--L--L--N--S--P--*-
GATATCCTAGCCCAAGTGAAGCCTCTGGGGCCCCAGCTAGCTGACCCTGAAGTTTTCCTACCCCAAGGAGAGTTACTCAACAGTCCATAA
::.::::::::: ::::::::::::::::::::::::::::::::::.::.::.:::::::::::.::::::::::...: :::::::::
GACATCCTAGCCAAAGTGAAGCCTCTGGGGCCCCAGCTAGCTGACCCCGAGGTCTTCCTACCCCAGGGAGAGTTACCTGAGAGTCCATAA
-D--I--L--A--K--V--K--P--L--G--P--Q--L--A--D--P--E--V--F--L--P--Q--G--E--L--P--E--S--P--*-

Pig Consensus Sequence

>BGISUST0000888488
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------CAGTCGGGAGCATCCTCGGCCAT
GGTGTTCCAGCCAGTGGGCTCTGGTGGGGTCCAGCCCTGTGGCGTTGGCTCTAGCGGCTCTAAAGGGCCCTGCTCCCTCTCCGGTTCTGGAGTCCACAGC
AGTTCTAGCATTTCAAGCAGTTCTGGTTCATCCTTCCATCCCTGTGGCACTGTTTCCCAGGGGCCCTGCTCGCCGCCTGGCACCGGCTCTTTCAGTGGCA
GCTCCAGCTCGAAATCTGGTGGCAAAATCATCCTTCAGCCCTGTGGCAGCAAGTCCAGCTCTTCTGGCCACCCTTGCATTTCTGTCTCCTCCTCGACCTT
GAGCGGGGGTCCAGATGGCTCTCCCCAACCTGATCCCTCAGCTGGTGCCAAGCCCTGTGGTTCCGGCAGCTCTGGAAAGATCCCCTGCCGCTCCATCCGG
GACATCCTAGCCAAAGTGAAGCCTCTGGGGCCCCAGCTAGCTGACCCCGAGGTCTTCCTACCCCAGGGAGAGTTACCTGAGAGTCCATAA


>BGISUSP0000888488
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------QSGASSAMVFQPVGSGGVQPCGVGSSGSKGPCSLSGSGVHS
SSSISSSSGSSFHPCGTVSQGPCSPPGTGSFSGSSSSKSGGKIILQPCGSKSSSSGHPCISVSSSTLSGGPDGSPQPDPSAGAKPCGSGSSGKIPCRSIR
DILAKVKPLGPQLADPEVFLPQGELPESP*