Sequences
EST Library Info
nep2Newborn 115 days, epidermis
Clusters
Oligos
SNPs

Gene ID ENSG00000137311 (click for geneview)
Transcript ID ENST00000259845(link to ensembl)
Symbol PSORS1C2
Localtion Chromosome:6:31213292:31215106:-1 band: 6p21.33
Description Psoriasis susceptibility 1 candidate gene 2 protein precursor (SPR1 protein). [Source:Uniprot/SWISSPROT;Acc:Q9UIG4]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------><--------------------------------------------
-M--I--L--N--W--K--L--L--G--I--L--V--L--C--L--H--T--R--G--I--S--G--S--E--G--H--P--S--H--P--P--A--E--
ATGATCCTCAACTGGAAGCTCCTGGGGATCCTGGTCCTTTGCCTGCACACCAGAGGCATCTCAGGCAGCGAGGGCCACCCCTCTCACCCACCCGCAGAGG
   :: :::::::::::::: ::::::::::::::::::::::::             ::   :  . .:..:.:::::: :::: ::::.::.:.::::
---ATGCTCAACTGGAAGCTACTGGGGATCCTGGTCCTTTGCCTG------------CTCAGTGCAGCTGGAGACCACCCATCTCCCCCATCCACGGAGG
----M--L--N--W--K--L--L--G--I--L--V--L--C--L--------------L--S--A--A--G--D--H--P--S--P--P--S--T--E--

----------------------------------------------------------------------------------------------------
D--R--E--E--A--G--S--P--T--L--P--Q--G--P--P--V--P--G--D--P--W--P--G--A--P--P--L--F--E--D--P--P--P--T
ACCGAGAGGAGGCAGGCTCCCCAACATTGCCTCAGGGCCCCCCAGTCCCCGGTGACCCTTGGCCAGGGGCACCCCCTCTCTTTGAAGATCCTCCGCCTAC
 :. :::::::: .:::::::::::::::::::.::::::::::.::::::::::::::::::::::::.:::.::: :::::::.::.:::::. :: :
CCTCAGAGGAGGAGGGCTCCCCAACATTGCCTCGGGGCCCCCCAATCCCCGGTGACCCTTGGCCAGGGGTACCTCCTATCTTTGAGGACCCTCCAGCTCC
A--S--E--E--E--G--S--P--T--L--P--R--G--P--P--I--P--G--D--P--W--P--G--V--P--P--I--F--E--D--P--P--A--P

----------------------------------------------------------------------------------------------------
--R--P--S--R--P--W--R--D--L--P--E--T--G--V--W--L--P--E--P--P--R--T--D--P--P--Q--P--P--R--P--D--D--P-
CCGCCCCAGTCGTCCCTGGAGAGACCTGCCTGAAACTGGAGTCTGGCTCCCTGAACCGCCTAGAACGGATCCTCCTCAACCTCCCCGGCCTGACGACCCT
  : ::::.::::::::::::::::::::::::  ::::::::::::..:::::::: ::::: :: :::::.::::::::::::::::::::::::::.
AGGGCCCAATCGTCCCTGGAGAGACCTGCCTGACTCTGGAGTCTGGCCTCCTGAACCCCCTAGTACTGATCCCCCTCAACCTCCCCGGCCTGACGACCCC
--G--P--N--R--P--W--R--D--L--P--D--S--G--V--W--P--P--E--P--P--S--T--D--P--P--Q--P--P--R--P--D--D--P-

----------------------------------------------------------------------------------------------------
-W--P--A--G--P--Q--P--P--E--N--P--W--P--P--A--P--E--V--D--N--R--P--Q--E--E--P--D--L--D--P--P--R--E--
TGGCCGGCAGGACCCCAGCCCCCAGAAAACCCCTGGCCTCCTGCCCCTGAGGTGGACAACCGACCTCAGGAGGAGCCAGACCTAGACCCACCCCGGGAAG
:::::.::::::::::::::.::::::::::::::::: :::::::::::::::::: :: ::.:.:..:::::::::::::: :::::::::       
TGGCCAGCAGGACCCCAGCCTCCAGAAAACCCCTGGCCACCTGCCCCTGAGGTGGACCACGGATCCCGAGAGGAGCCAGACCTTGACCCACCC-------
-W--P--A--G--P--Q--P--P--E--N--P--W--P--P--A--P--E--V--D--H--G--S--R--E--E--P--D--L--D--P--P--------

---------->
E--Y--R--*-
AGTACAGATAA
           
-----------
-----------

Pig Consensus Sequence

>BGISUST0000887085
---ATGCTCAACTGGAAGCTACTGGGGATCCTGGTCCTTTGCCTG------------CTCAGTGCAGCTGGAGACCACCCATCTCCCCCATCCACGGAGG
CCTCAGAGGAGGAGGGCTCCCCAACATTGCCTCGGGGCCCCCCAATCCCCGGTGACCCTTGGCCAGGGGTACCTCCTATCTTTGAGGACCCTCCAGCTCC
AGGGCCCAATCGTCCCTGGAGAGACCTGCCTGACTCTGGAGTCTGGCCTCCTGAACCCCCTAGTACTGATCCCCCTCAACCTCCCCGGCCTGACGACCCC
TGGCCAGCAGGACCCCAGCCTCCAGAAAACCCCTGGCCACCTGCCCCTGAGGTGGACCACGGATCCCGAGAGGAGCCAGACCTTGACCCACCC-------
-----------


>BGISUSP0000887085
-MLNWKLLGILVLCL----LSAAGDHPSPPSTEASEEEGSPTLPRGPPIPGDPWPGVPPIFEDPPAPGPNRPWRDLPDSGVWPPEPPSTDPPQPPRPDDP
WPAGPQPPENPWPPAPEVDHGSREEPDLDPP------