Sequences
EST Library Info
cad1Unavailable
cbl3Blood
che1Heart - RNA from China
cov3Ovary - RNA from China
fat5Fatt
fcc2Unavailable
hyp1Hypothalamus
jej1Small intestine, jejunum
lnt1Lymphatic nodule tracheobroncalis
nca3Newborn 115 days, cartillage
nco1Newborn 115 days, colon
nlu1Newborn 115 days, lung
nmm1Newborn 115 days, mucosal membranes
pigcb4Unavailable
plac2Unavailable
plun2Unavailable
ton1Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000137312 (click for geneview)
Transcript ID ENST00000259846(link to ensembl)
Symbol FLOT1
Localtion Chromosome:6:30803492:30818432:-1 band: 6p21.33
Description Flotillin-1. [Source:Uniprot/SWISSPROT;Acc:O75955]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------><--------------------------------------------------------
-M--F--F--T--C--G--P--N--E--A--M--V--V--S--G--F--C--R--S--P--P--V--M--V--A--G--G--R--V--F--V--L--P--
ATGTTTTTCACTTGTGGCCCAAATGAGGCCATGGTGGTCTCCGGGTTCTGCCGAAGCCCCCCAGTCATGGTGGCTGGAGGGCGTGTCTTTGTCCTGCCCT
:::::::::::.:::::::::::.:::::::::::::::      ::::::::.:::::::::::::::::::::::::: :::::::::::::::::::
ATGTTTTTCACCTGTGGCCCAAACGAGGCCATGGTGGTC------TTCTGCCGGAGCCCCCCAGTCATGGTGGCTGGAGGTCGTGTCTTTGTCCTGCCCT
-M--F--F--T--C--G--P--N--E--A--M--V--V--------F--C--R--S--P--P--V--M--V--A--G--G--R--V--F--V--L--P--

------------------><--------------------------------------------------------------------------------
C--I--Q--Q--I--Q--R--I--S--L--N--T--L--T--L--N--V--K--S--E--K--V--Y--T--R--H--G--V--P--I--S--V--T--G
GCATCCAACAGATCCAGAGGATCTCTCTCAACACACTGACCCTCAATGTCAAGAGTGAAAAGGTTTACACTCGCCATGGGGTCCCCATCTCAGTCACTGG
:::::::.::.::::::   :::::::::::::::.::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GCATCCAGCAAATCCAG---ATCTCTCTCAACACATTGACTCTCAATGTCAAGAGTGAAAAGGTTTACACTCGCCATGGGGTCCCCATCTCAGTCACTGG
C--I--Q--Q--I--Q-----I--S--L--N--T--L--T--L--N--V--K--S--E--K--V--Y--T--R--H--G--V--P--I--S--V--T--G

---------><-----------------------------------------------------------------------------------------
--I--A--Q--V--K--I--Q--G--Q--N--K--E--M--L--A--A--A--C--Q--M--F--L--G--K--T--E--A--E--I--A--H--I--A-
CATTGCCCAGGTAAAAATCCAGGGGCAGAACAAGGAGATGTTGGCGGCCGCCTGTCAGATGTTCCTGGGGAAGACGGAGGCTGAGATTGCCCACATTGCC
::::::::::::.::::::::::: :::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::.:: 
CATTGCCCAGGTGAAAATCCAGGGCCAGAACAAGGAGATGTTGGCGGCTGCCTGCCAGATGTTCCTGGGGAAGACGGAGGCTGAGATTGCCCACATCGCA
--I--A--Q--V--K--I--Q--G--Q--N--K--E--M--L--A--A--A--C--Q--M--F--L--G--K--T--E--A--E--I--A--H--I--A-

-----------------------------------------------------><---------------------------------------------
-L--E--T--L--E--G--H--Q--R--A--I--M--A--H--M--T--V--E--E--I--Y--K--D--R--Q--K--F--S--E--Q--V--F--K--
CTGGAGACGTTAGAGGGCCACCAGAGGGCCATCATGGCCCACATGACTGTGGAGGAGATCTATAAGGACAGGCAGAAATTCTCAGAACAGGTTTTCAAAG
:::::::::.:.:::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::::: ::.::.::::::::::
CTGGAGACGCTGGAGGGCCACCAGAGGGCTATCATGGCCCACATGACTGTGGAGGAAATCTATAAGGACAGGCAGAAATTCTCTGAGCAAGTTTTCAAAG
-L--E--T--L--E--G--H--Q--R--A--I--M--A--H--M--T--V--E--E--I--Y--K--D--R--Q--K--F--S--E--Q--V--F--K--

-------------------------------------------------------------------------><-------------------------
V--A--S--S--D--L--V--N--M--G--I--S--V--V--S--Y--T--L--K--D--I--H--D--D--Q--D--Y--L--H--S--L--G--K--A
TGGCCTCCTCAGACCTGGTCAACATGGGCATCAGTGTGGTTAGCTACACTCTGAAGGACATTCACGATGACCAGGACTATTTGCACTCTTTGGGGAAGGC
::::::::::::::::::::::::::::::::::.:::::.::::::::.::::::::::::::::::::.:::::::::::::::::.:::::::::::
TGGCCTCCTCAGACCTGGTCAACATGGGCATCAGCGTGGTCAGCTACACCCTGAAGGACATTCACGATGATCAGGACTATTTGCACTCCTTGGGGAAGGC
V--A--S--S--D--L--V--N--M--G--I--S--V--V--S--Y--T--L--K--D--I--H--D--D--Q--D--Y--L--H--S--L--G--K--A

---------------------------------------------------------------------><-----------------------------
--R--T--A--Q--V--Q--K--D--A--R--I--G--E--A--E--A--K--R--D--A--G--I--R--E--A--K--A--K--Q--E--K--V--S-
TCGAACAGCTCAAGTCCAAAAAGATGCACGGATTGGAGAAGCAGAGGCCAAGAGAGATGCTGGGATCCGGGAAGCTAAAGCCAAGCAGGAAAAGGTGTCT
.:::::::::::::::::::::::::: ::::::::.::::::::.::::::::::::::::::::::::::.::.::::::::::::::::::::::::
CCGAACAGCTCAAGTCCAAAAAGATGCTCGGATTGGGGAAGCAGAAGCCAAGAGAGATGCTGGGATCCGGGAGGCCAAAGCCAAGCAGGAAAAGGTGTCT
--R--T--A--Q--V--Q--K--D--A--R--I--G--E--A--E--A--K--R--D--A--G--I--R--E--A--K--A--K--Q--E--K--V--S-

----------------------------------------------------------------------------------------------------
-A--Q--Y--L--S--E--I--E--M--A--K--A--Q--R--D--Y--E--L--K--K--A--A--Y--D--I--E--V--N--T--R--R--A--Q--
GCTCAGTACCTGAGTGAGATCGAGATGGCCAAGGCACAGAGAGATTACGAACTGAAGAAGGCCGCCTATGACATCGAGGTCAACACCCGCCGAGCACAGG
:::::.:::::::::::::::::::::::::::::.:::::.::.:::::.:::::::::::.:::::::::::::::::::::::::: :::::.::::
GCTCAATACCTGAGTGAGATCGAGATGGCCAAGGCGCAGAGGGACTACGAGCTGAAGAAGGCTGCCTATGACATCGAGGTCAACACCCGGCGAGCGCAGG
-A--Q--Y--L--S--E--I--E--M--A--K--A--Q--R--D--Y--E--L--K--K--A--A--Y--D--I--E--V--N--T--R--R--A--Q--

----------------------><----------------------------------------------------------------------------
A--D--L--A--Y--Q--L--Q--V--A--K--T--K--Q--Q--I--E--E--Q--R--V--Q--V--Q--V--V--E--R--A--Q--Q--V--A--V
CTGACCTGGCCTATCAGCTTCAGGTGGCCAAGACTAAGCAGCAGATTGAGGAGCAGCGGGTGCAGGTGCAGGTGGTGGAGCGGGCCCAGCAGGTGGCAGT
:::::::::::::::::::::::::::: ::::: :::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.::
CTGACCTGGCCTATCAGCTTCAGGTGGCGAAGACGAAGCAGCAGATCGAGGAGCAGCGGGTGCAGGTGCAGGTGGTGGAGCGGGCCCAGCAGGTGGCGGT
A--D--L--A--Y--Q--L--Q--V--A--K--T--K--Q--Q--I--E--E--Q--R--V--Q--V--Q--V--V--E--R--A--Q--Q--V--A--V

----------------------------------------------------------------------------------------------------
--Q--E--Q--E--I--A--R--R--E--K--E--L--E--A--R--V--R--K--P--A--E--A--E--R--Y--K--L--E--R--L--A--E--A-
GCAGGAGCAGGAGATCGCCCGGCGGGAGAAGGAGCTGGAGGCCCGGGTGCGGAAGCCAGCGGAAGCGGAGCGCTACAAGCTGGAGCGCCTAGCCGAGGCA
::::::::::::::::::::: :: :::::::::::::::::::: :::::::::::.:::::::: ::::::::::::::::::::::: :: : :::.
GCAGGAGCAGGAGATCGCCCGCCGCGAGAAGGAGCTGGAGGCCCGCGTGCGGAAGCCGGCGGAAGCCGAGCGCTACAAGCTGGAGCGCCTCGCGGCGGCG
--Q--E--Q--E--I--A--R--R--E--K--E--L--E--A--R--V--R--K--P--A--E--A--E--R--Y--K--L--E--R--L--A--A--A-

----><--------------------------------------------><------------------------------------------------
-E--K--S--Q--L--I--M--Q--A--E--A--E--A--A--S--V--R--M--R--G--E--A--E--A--F--A--I--G--A--R--A--R--A--
GAGAAGTCCCAACTAATTATGCAGGCGGAGGCAGAAGCCGCGTCTGTGCGGATGCGTGGGGAAGCTGAGGCCTTTGCCATAGGGGCCCGAGCCCGAGCCG
:::                                                :::::::::::.::.:::::::::::::: ::::::::::::::.:: :
GAG------------------------------------------------ATGCGTGGGGAGGCCGAGGCCTTTGCCATTGGGGCCCGAGCCCGGGCGG
-E--------------------------------------------------M--R--G--E--A--E--A--F--A--I--G--A--R--A--R--A--

----------------------------------------------------------------------------------------><----------
E--A--E--Q--M--A--K--K--A--E--A--F--Q--L--Y--Q--E--A--A--Q--L--D--M--L--L--E--K--L--P--Q--V--A--E--E
AGGCTGAGCAGATGGCCAAGAAGGCAGAAGCCTTCCAGCTGTACCAAGAGGCTGCTCAGCTGGACATGCTGCTAGAGAAGCTGCCCCAGGTGGCAGAGGA
:::::::::::::::::::::::::.::.::.::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::
AGGCTGAGCAGATGGCCAAGAAGGCGGAGGCTTTCCAGCTGTACCAGGAGGCTGCTCAGCTGGACATGCTGCTAGAGAAGCTGCCCCAGGTGGCAGAGGA
E--A--E--Q--M--A--K--K--A--E--A--F--Q--L--Y--Q--E--A--A--Q--L--D--M--L--L--E--K--L--P--Q--V--A--E--E

----------------------------------------------------------------------------------------------------
--I--S--G--P--L--T--S--A--N--K--I--T--L--V--S--S--G--S--G--T--M--G--A--A--K--V--T--G--E--V--L--D--I-
GATCAGTGGTCCCTTGACTTCAGCCAATAAGATCACACTGGTGTCCAGCGGCAGTGGGACCATGGGGGCAGCCAAAGTGACTGGGGAAGTACTGGACATT
::::::::::::::::::.::.::::: :::::.::::::::::::::.:: ::.::::::::::::::.:::::::::::.::::::::.::::::::.
GATCAGTGGTCCCTTGACCTCGGCCAAGAAGATTACACTGGTGTCCAGTGGAAGCGGGACCATGGGGGCGGCCAAAGTGACCGGGGAAGTGCTGGACATC
--I--S--G--P--L--T--S--A--K--K--I--T--L--V--S--S--G--S--G--T--M--G--A--A--K--V--T--G--E--V--L--D--I-

-----------------------------------------------------><---------------------------->
-L--T--R--L--P--E--S--V--E--R--L--T--G--V--S--I--S--Q--V--N--H--K--P--L--R--T--A--*-
CTAACTCGCCTGCCAGAGAGTGTGGAAAGACTCACAGGCGTGAGCATCTCCCAGGTGAATCACAAGCCTTTGAGAACAGCCTGA
::.: .::::::::::::::.:::::.:::::::: ::::: ::::::::::::                              
CTGAGCCGCCTGCCAGAGAGCGTGGAGAGACTCACTGGCGTCAGCATCTCCCAG------------------------------
-L--S--R--L--P--E--S--V--E--R--L--T--G--V--S--I--S--Q-------------------------------

Pig Consensus Sequence

>BGISUST0000894621
ATGTTTTTCACCTGTGGCCCAAACGAGGCCATGGTGGTC------TTCTGCCGGAGCCCCCCAGTCATGGTGGCTGGAGGTCGTGTCTTTGTCCTGCCCT
GCATCCAGCAAATCCAG---ATCTCTCTCAACACATTGACTCTCAATGTCAAGAGTGAAAAGGTTTACACTCGCCATGGGGTCCCCATCTCAGTCACTGG
CATTGCCCAGGTGAAAATCCAGGGCCAGAACAAGGAGATGTTGGCGGCTGCCTGCCAGATGTTCCTGGGGAAGACGGAGGCTGAGATTGCCCACATCGCA
CTGGAGACGCTGGAGGGCCACCAGAGGGCTATCATGGCCCACATGACTGTGGAGGAAATCTATAAGGACAGGCAGAAATTCTCTGAGCAAGTTTTCAAAG
TGGCCTCCTCAGACCTGGTCAACATGGGCATCAGCGTGGTCAGCTACACCCTGAAGGACATTCACGATGATCAGGACTATTTGCACTCCTTGGGGAAGGC
CCGAACAGCTCAAGTCCAAAAAGATGCTCGGATTGGGGAAGCAGAAGCCAAGAGAGATGCTGGGATCCGGGAGGCCAAAGCCAAGCAGGAAAAGGTGTCT
GCTCAATACCTGAGTGAGATCGAGATGGCCAAGGCGCAGAGGGACTACGAGCTGAAGAAGGCTGCCTATGACATCGAGGTCAACACCCGGCGAGCGCAGG
CTGACCTGGCCTATCAGCTTCAGGTGGCGAAGACGAAGCAGCAGATCGAGGAGCAGCGGGTGCAGGTGCAGGTGGTGGAGCGGGCCCAGCAGGTGGCGGT
GCAGGAGCAGGAGATCGCCCGCCGCGAGAAGGAGCTGGAGGCCCGCGTGCGGAAGCCGGCGGAAGCCGAGCGCTACAAGCTGGAGCGCCTCGCGGCGGCG
GAG------------------------------------------------ATGCGTGGGGAGGCCGAGGCCTTTGCCATTGGGGCCCGAGCCCGGGCGG
AGGCTGAGCAGATGGCCAAGAAGGCGGAGGCTTTCCAGCTGTACCAGGAGGCTGCTCAGCTGGACATGCTGCTAGAGAAGCTGCCCCAGGTGGCAGAGGA
GATCAGTGGTCCCTTGACCTCGGCCAAGAAGATTACACTGGTGTCCAGTGGAAGCGGGACCATGGGGGCGGCCAAAGTGACCGGGGAAGTGCTGGACATC
CTGAGCCGCCTGCCAGAGAGCGTGGAGAGACTCACTGGCGTCAGCATCTCCCAG------------------------------


>BGISUSP0000894621
MFFTCGPNEAMVV--FCRSPPVMVAGGRVFVLPCIQQIQ-ISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIA
LETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVS
AQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAAA
E----------------MRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSAKKITLVSSGSGTMGAAKVTGEVLDI
LSRLPESVERLTGVSISQ----------