Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000137314 (click for geneview)
Transcript ID ENST00000259848(link to ensembl)
Symbol PPP1R10
Localtion Chromosome:6:30676162:30692999:-1 band: 6p21.33
Description Protein phosphatase 1 regulatory subunit 10 (Phosphatase 1 nuclear targeting subunit) (MHC class I region proline rich protein CAT53) (FB19 protein) (PP1-binding protein of 114 kDa) (p99). [Source:Uniprot/SWISSPROT;Acc:Q96QC0]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--S--G--P--I--D--P--K--E--L--L--K--G--L--D--S--F--L--N--R--D--G--E--V--K--S--V--D--G--I--S--K--
ATGGGTTCGGGTCCCATAGACCCCAAAGAACTTCTCAAGGGCCTGGACAGCTTCCTTAACCGAGATGGGGAAGTCAAAAGTGTGGATGGGATTTCCAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------><-------------------------------------------------------------------------------------><-----
I--F--S--L--M--K--E--A--R--K--M--V--S--R--C--T--Y--L--N--I--L--L--Q--T--R--S--P--E--I--L--V--K--F--I
TCTTCAGTTTGATGAAGGAAGCACGAAAGATGGTGAGTCGATGCACTTACTTGAACATTCTCCTGCAGACCCGTTCACCAGAAATATTGGTCAAATTTAT
        .:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::.:::::        
--------CTGATGAAGGAAGCACGAAAGATGGTGAGTCGATGCACTTACTTGAACATTCTCCTGCAGACTCGTTCACCAGAAATACTGGTC--------
---------L--M--K--E--A--R--K--M--V--S--R--C--T--Y--L--N--I--L--L--Q--T--R--S--P--E--I--L--V---------

----------------------------------------------------------------------------------------------------
--D--V--G--G--Y--K--L--L--N--N--W--L--T--Y--S--K--T--T--N--N--I--P--L--L--Q--Q--I--L--L--T--L--Q--H-
TGACGTTGGCGGCTACAAACTTCTTAACAATTGGCTGACGTATTCAAAGACAACCAACAACATTCCCCTCCTCCAGCAAATTCTACTGACCCTGCAGCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------><--------------------------------------------------><-----------------
-L--P--L--T--V--D--H--L--K--Q--N--N--T--A--K--L--V--K--Q--L--S--K--S--S--E--D--E--E--L--R--K--L--A--
CTACCGCTCACTGTAGACCATCTCAAGCAGAACAACACAGCTAAACTGGTGAAGCAGCTGAGCAAGTCAAGTGAGGATGAAGAGCTCCGGAAATTGGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------><---------------------------------------
S--V--L--V--S--D--W--M--A--V--I--R--S--Q--S--S--T--Q--P--A--E--K--D--K--K--K--R--K--D--E--G--K--S--R
CAGTCCTTGTCAGCGACTGGATGGCTGTCATCCGCTCTCAGAGCAGTACCCAGCCTGCTGAGAAAGATAAGAAGAAACGTAAAGATGAAGGAAAAAGTCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--T--L--P--E--R--P--L--T--E--V--K--A--E--T--R--A--E--E--A--P--E--K--K--R--E--K--P--K--S--L--R--T-
AACTACCCTTCCTGAGCGACCTTTGACAGAGGTGAAGGCTGAGACCCGGGCTGAGGAGGCCCCAGAGAAGAAGAGGGAGAAGCCCAAGTCTCTTCGCACC
                                                          ::::::::::::::::::::::::::.::::::::.::::::
----------------------------------------------------------GCCCCAGAGAAGAAGAGGGAGAAGCCTAAGTCTCTCCGCACC
-----------------------------------------------------------A--P--E--K--K--R--E--K--P--K--S--L--R--T-

---------------------------------><-----------------------------------------------------------------
-T--A--P--S--H--A--K--F--R--S--T--G--L--E--L--E--T--P--S--L--V--P--V--K--K--N--A--S--T--V--V--V--S--
ACAGCACCCAGTCATGCCAAGTTCCGTTCCACTGGACTAGAGCTGGAGACACCATCCTTGGTGCCTGTGAAGAAGAATGCCAGCACAGTGGTGGTTTCTG
::.::.::::::::.:::::::::::::::      ::.::::::::::: ::.::.::::::::.:::::::::::::::::..:::::::::::::::
ACGGCGCCCAGTCACGCCAAGTTCCGTTCC------CTGGAGCTGGAGACCCCGTCTTTGGTGCCCGTGAAGAAGAATGCCAGTGCAGTGGTGGTTTCTG
-T--A--P--S--H--A--K--F--R--S--------L--E--L--E--T--P--S--L--V--P--V--K--K--N--A--S--A--V--V--V--S--

---------------------------------------><-----------------------------------------------------------
D--K--Y--N--L--K--P--I--P--L--K--R--Q--S--N--V--A--A--P--G--D--A--T--P--P--A--E--K--K--Y--K--P--L--N
ACAAGTACAACCTTAAACCCATCCCCCTCAAACGTCAGAGCAACGTAGCTGCTCCAGGAGATGCCACTCCCCCTGCAGAGAAGAAATACAAGCCACTCAA
::::::::::::::::::::::::: :::::.::::::     :.:::::::.:..:: :::::..:.:::::::::::::::::.::::::::::::::
ACAAGTACAACCTTAAACCCATCCCGCTCAAGCGTCAG---TCCATAGCTGCCCTGGGTGATGCTGCCCCCCCTGCAGAGAAGAAGTACAAGCCACTCAA
D--K--Y--N--L--K--P--I--P--L--K--R--Q-----S--I--A--A--L--G--D--A--A--P--P--A--E--K--K--Y--K--P--L--N

----------------------------------------------------><----------------------------------------------
--T--T--P--N--A--T--K--E--I--K--V--K--I--I--P--P--Q--P--M--E--G--L--G--F--L--D--A--L--N--S--A--P--V-
CACAACACCTAATGCCACCAAAGAGATCAAAGTGAAGATCATCCCGCCACAGCCTATGGAGGGCCTGGGCTTTCTGGATGCTCTTAATTCAGCCCCTGTT
:::.:: ::.:::::::::::::::::::::::::::::::::::.::::::   ::::::::::::::::::::.::::: ::.:::::::::::::::
CACGACCCCCAATGCCACCAAAGAGATCAAAGTGAAGATCATCCCACCACAG---ATGGAGGGCCTGGGCTTTCTAGATGCGCTCAATTCAGCCCCTGTT
--T--T--P--N--A--T--K--E--I--K--V--K--I--I--P--P--Q-----M--E--G--L--G--F--L--D--A--L--N--S--A--P--V-

-----------------------------------------------------><---------------------------------------------
-P--G--I--K--I--K--K--K--K--K--V--L--S--P--T--A--A--K--P--S--P--F--E--G--K--T--S--T--E--P--S--T--A--
CCAGGCATCAAAATTAAGAAGAAAAAAAAAGTACTGTCACCTACGGCTGCCAAGCCAAGCCCCTTTGAAGGGAAAACGAGCACAGAACCAAGCACAGCCA
:::::::::::::::::::::::.::.::.::.::::::::.::.:: ::::::                                              
CCAGGCATCAAAATTAAGAAGAAGAAGAAGGTGCTGTCACCCACAGCGGCCAAG----------------------------------------------
-P--G--I--K--I--K--K--K--K--K--V--L--S--P--T--A--A--K-----------------------------------------------

----------------------------------------------------------------------------------------------------
K--P--S--S--P--E--P--A--P--P--S--E--A--M--D--A--D--R--P--G--T--P--V--P--P--V--E--V--P--E--L--M--D--T
AACCTTCTTCCCCAGAACCAGCACCACCTTCTGAGGCAATGGACGCAGACCGTCCAGGCACCCCGGTTCCCCCTGTTGAAGTCCCGGAGCTCATGGATAC
                                ::::: ::::::.:::::::::: :: :::::.:::::::::::.:::::::::::::::::::::  
--------------------------------GAGGCTATGGACACAGACCGTCCCGGGACCCCAGTTCCCCCTGTCGAAGTCCCGGAGCTCATGGAT--
---------------------------------E--A--M--D--T--D--R--P--G--T--P--V--P--P--V--E--V--P--E--L--M--D---

-><-------------------------------------------------------------------------------------------------
--A--S--L--E--P--G--A--L--D--A--K--P--V--E--S--P--G--D--P--N--Q--L--T--R--K--G--R--K--R--K--S--V--T-
AGCCTCTTTGGAGCCAGGAGCTCTGGATGCCAAGCCAGTGGAGAGTCCTGGAGATCCTAACCAACTGACCCGGAAAGGCAGGAAGAGGAAAAGTGTGACA
    ::::::::::::::::::::::: :: :::::::::::::::::.::::::::.:.:::.::::: :::::::::::::::::::::: ::::::.
----TCTTTGGAGCCAGGAGCTCTGGAAGCAAAGCCAGTGGAGAGTCCCGGAGATCCCAGCCAGCTGACACGGAAAGGCAGGAAGAGGAAAACTGTGACG
-----S--L--E--P--G--A--L--E--A--K--P--V--E--S--P--G--D--P--S--Q--L--T--R--K--G--R--K--R--K--T--V--T-

------------------------------------------------------------><--------------------------------------
-W--P--E--E--G--K--L--R--E--Y--F--Y--F--E--L--D--E--T--E--R--V--N--V--N--K--I--K--D--F--G--E--A--A--
TGGCCTGAGGAAGGCAAACTGAGAGAATATTTCTATTTTGAATTGGATGAAACTGAACGAGTAAATGTGAATAAGATCAAGGACTTTGGTGAGGCGGCTA
:::::::::::.::::::::::::::.::::::::::::::..:::::::.:::::::::   ::::::::::::::::::::::::::.:::::.::.:
TGGCCTGAGGAGGGCAAACTGAGAGAGTATTTCTATTTTGAGCTGGATGAGACTGAACGA---AATGTGAATAAGATCAAGGACTTTGGCGAGGCAGCCA
-W--P--E--E--G--K--L--R--E--Y--F--Y--F--E--L--D--E--T--E--R-----N--V--N--K--I--K--D--F--G--E--A--A--

----------------------------------------------------------------------------------------------------
K--R--E--I--L--S--D--R--H--A--F--E--T--A--R--R--L--S--H--D--N--M--E--E--K--V--P--W--V--C--P--R--P--L
AGCGAGAGATACTGTCAGACCGACATGCATTTGAGACAGCGCGGCGTCTGAGCCATGATAACATGGAGGAGAAGGTGCCCTGGGTGTGCCCCCGGCCCCT
:::::::::::::::::::::::::.::.::::::::.:: ::::::::::::::.::.:::::::::::::::::::::::::: :::::::::::.::
AGCGAGAGATACTGTCAGACCGACACGCGTTTGAGACGGCCCGGCGTCTGAGCCACGACAACATGGAGGAGAAGGTGCCCTGGGTCTGCCCCCGGCCTCT
K--R--E--I--L--S--D--R--H--A--F--E--T--A--R--R--L--S--H--D--N--M--E--E--K--V--P--W--V--C--P--R--P--L

----------------------------------------------------------------------------------------------------
--V--L--P--S--P--L--V--T--P--G--S--N--S--Q--E--R--Y--I--Q--A--E--R--E--K--G--I--L--Q--E--L--F--L--N-
GGTTCTGCCCTCACCTCTTGTCACCCCTGGAAGCAATAGTCAGGAGCGATATATCCAGGCTGAGCGGGAGAAGGGAATCCTTCAGGAGCTCTTCCTGAAC
::: ::::::::.:::::.::::::::::::::::::::.::::::::.::.:::::::::::::::::::::::.::::::::::::::.:::::::::
GGTGCTGCCCTCGCCTCTCGTCACCCCTGGAAGCAATAGCCAGGAGCGGTACATCCAGGCTGAGCGGGAGAAGGGGATCCTTCAGGAGCTTTTCCTGAAC
--V--L--P--S--P--L--V--T--P--G--S--N--S--Q--E--R--Y--I--Q--A--E--R--E--K--G--I--L--Q--E--L--F--L--N-

-------><--------------------------------------------------------------><---------------------------
-K--E--S--P--H--E--P--D--P--E--P--Y--E--P--I--P--P--K--L--I--P--L--D--E--E--C--S--M--D--E--T--P--Y--
AAGGAGAGTCCTCATGAGCCTGATCCTGAGCCCTACGAGCCCATACCCCCTAAACTCATCCCCCTAGATGAGGAGTGTTCCATGGATGAGACTCCGTATG
::::::   ::::::::::::::::::::::::::.::.:::.: ::::: :::                                              
AAGGAG---CCTCATGAGCCTGATCCTGAGCCCTATGAACCCGTCCCCCCAAAA----------------------------------------------
-K--E-----P--H--E--P--D--P--E--P--Y--E--P--V--P--P--K-----------------------------------------------

----------------------------------------------------------------------------------------------------
V--E--T--L--E--P--G--G--S--G--G--S--P--D--G--A--G--G--S--K--L--P--P--V--L--A--N--L--M--G--S--M--G--A
TTGAGACTCTGGAACCTGGGGGGTCAGGTGGCTCACCTGATGGGGCAGGAGGCTCCAAGTTGCCTCCAGTTCTGGCCAATCTTATGGGAAGCATGGGTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------><--------------------------------
--G--K--G--P--Q--G--P--G--G--G--G--I--N--V--Q--E--I--L--T--S--I--M--G--S--P--N--S--H--P--S--E--E--L-
TGGAAAGGGCCCCCAAGGCCCTGGAGGAGGAGGCATTAATGTCCAAGAGATCCTCACCTCCATCATGGGTAGCCCAAACAGTCATCCTTCAGAGGAACTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------><--------------------------------------------------------
-L--K--Q--P--D--Y--S--D--K--I--K--Q--M--L--V--P--H--G--L--L--G--P--G--P--I--A--N--G--F--P--P--G--G--
CTGAAACAACCAGACTATTCGGACAAGATCAAGCAGATGCTGGTGCCACATGGACTCCTAGGCCCTGGCCCAATAGCCAATGGTTTCCCACCAGGGGGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------><------------------------------------------
P--G--G--P--K--G--M--Q--H--F--P--P--G--P--G--G--P--M--P--G--P--H--G--G--P--G--G--P--V--G--P--R--L--L
CTGGGGGCCCCAAGGGCATGCAGCACTTTCCCCCTGGACCTGGGGGACCTATGCCAGGTCCCCATGGAGGCCCTGGTGGGCCAGTGGGTCCACGTCTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--P--P--P--P--P--R--G--G--D--P--F--W--D--G--P--G--D--P--M--R--G--G--P--M--R--G--G--P--G--P--G--P-
GGGTCCTCCACCCCCTCCCCGGGGAGGTGATCCCTTCTGGGATGGCCCGGGCGACCCTATGCGGGGTGGCCCAATGCGGGGGGGTCCAGGACCAGGTCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--P--Y--H--R--G--R--G--G--R--G--G--N--E--P--P--P--P--P--P--P--F--R--G--A--R--G--G--R--S--G--G--G--
GGACCATACCATAGAGGCCGAGGTGGCCGAGGAGGAAACGAACCTCCTCCTCCTCCTCCTCCATTCCGAGGCGCCAGAGGAGGTCGCTCTGGAGGAGGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--P--N--G--R--G--G--P--G--G--G--M--V--G--G--G--G--H--R--P--H--E--G--P--G--G--G--M--G--N--S--S--G--H
CCCCAAATGGACGAGGGGGCCCTGGTGGGGGCATGGTTGGAGGTGGTGGGCATCGTCCTCACGAAGGCCCTGGTGGGGGCATGGGCAACAGCAGTGGACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--P--H--E--G--P--G--G--G--M--G--S--G--H--R--P--H--E--G--P--G--G--S--M--G--G--G--G--G--H--R--P--H-
TCGTCCCCACGAAGGCCCTGGCGGTGGCATGGGAAGTGGGCATCGCCCCCATGAAGGCCCTGGTGGTAGCATGGGTGGGGGTGGAGGACATCGTCCCCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--G--P--G--G--G--I--S--G--G--S--G--H--R--P--H--E--G--P--G--G--G--M--G--A--G--G--G--H--R--P--H--E--
GAAGGCCCTGGCGGTGGCATCAGTGGTGGCAGTGGCCATCGTCCCCATGAAGGCCCTGGCGGAGGAATGGGTGCCGGTGGTGGACATCGCCCCCACGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--P--G--G--S--M--G--G--S--G--G--H--R--P--H--E--G--P--G--H--G--G--P--H--G--H--R--P--H--D--V--P--G--H
GCCCTGGCGGAAGCATGGGTGGAAGTGGTGGACATCGTCCCCATGAAGGCCCTGGACACGGGGGGCCCCATGGCCACCGGCCTCATGATGTCCCTGGTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--G--H--D--H--R--G--P--P--P--H--E--H--R--G--H--D--G--P--G--H--G--G--G--G--H--R--G--H--D--G--G--H-
CCGAGGCCATGACCATCGAGGGCCGCCACCTCATGAGCACCGTGGCCATGATGGTCCTGGCCACGGGGGAGGGGGCCACCGAGGGCACGATGGAGGCCAC
          :::::: :::::::::::::::::::.:::::::::::::::::.:::::.:::::.::::::::::::::::::::.::::::::::::
----------GACCATAGAGGGCCGCCACCTCATGAACACCGTGGCCATGATGGCCCTGGTCACGGAGGAGGGGGCCACCGAGGGCATGATGGAGGCCAC
-----------D--H--R--G--P--P--P--H--E--H--R--G--H--D--G--P--G--H--G--G--G--G--H--R--G--H--D--G--G--H-

------------><--------------------------------------------------------------------------------------
-S--H--G--G--D--M--S--N--R--P--V--C--R--H--F--M--M--K--G--N--C--R--Y--E--N--N--C--A--F--Y--H--P--G--
AGCCATGGAGGAGACATGTCAAACCGCCCTGTCTGCCGACATTTCATGATGAAGGGCAACTGCCGCTATGAGAACAACTGTGCCTTCTACCACCCGGGTG
:.:::.::::::   :::::::: :::::.::.::.::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::
AACCACGGAGGA---ATGTCAAAGCGCCCCGTTTGTCGACATTTCATGATGAAGGGCAACTGCCGCTACGAGAACAACTGTGCCTTCTACCACCCGGGTG
-N--H--G--G-----M--S--K--R--P--V--C--R--H--F--M--M--K--G--N--C--R--Y--E--N--N--C--A--F--Y--H--P--G--

---------------------->
V--N--G--P--P--L--P--*-
TCAATGGGCCCCCCCTGCCCTAG
:::::::::::::::::::::::
TCAATGGGCCCCCCCTGCCCTAG
V--N--G--P--P--L--P--*-

Pig Consensus Sequence

>BGISUST0000892457
----------------------------------------------------------------------------------------------------
--------CTGATGAAGGAAGCACGAAAGATGGTGAGTCGATGCACTTACTTGAACATTCTCCTGCAGACTCGTTCACCAGAAATACTGGTC--------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------GCCCCAGAGAAGAAGAGGGAGAAGCCTAAGTCTCTCCGCACC
ACGGCGCCCAGTCACGCCAAGTTCCGTTCC------CTGGAGCTGGAGACCCCGTCTTTGGTGCCCGTGAAGAAGAATGCCAGTGCAGTGGTGGTTTCTG
ACAAGTACAACCTTAAACCCATCCCGCTCAAGCGTCAG---TCCATAGCTGCCCTGGGTGATGCTGCCCCCCCTGCAGAGAAGAAGTACAAGCCACTCAA
CACGACCCCCAATGCCACCAAAGAGATCAAAGTGAAGATCATCCCACCACAG---ATGGAGGGCCTGGGCTTTCTAGATGCGCTCAATTCAGCCCCTGTT
CCAGGCATCAAAATTAAGAAGAAGAAGAAGGTGCTGTCACCCACAGCGGCCAAG----------------------------------------------
--------------------------------GAGGCTATGGACACAGACCGTCCCGGGACCCCAGTTCCCCCTGTCGAAGTCCCGGAGCTCATGGAT--
----TCTTTGGAGCCAGGAGCTCTGGAAGCAAAGCCAGTGGAGAGTCCCGGAGATCCCAGCCAGCTGACACGGAAAGGCAGGAAGAGGAAAACTGTGACG
TGGCCTGAGGAGGGCAAACTGAGAGAGTATTTCTATTTTGAGCTGGATGAGACTGAACGA---AATGTGAATAAGATCAAGGACTTTGGCGAGGCAGCCA
AGCGAGAGATACTGTCAGACCGACACGCGTTTGAGACGGCCCGGCGTCTGAGCCACGACAACATGGAGGAGAAGGTGCCCTGGGTCTGCCCCCGGCCTCT
GGTGCTGCCCTCGCCTCTCGTCACCCCTGGAAGCAATAGCCAGGAGCGGTACATCCAGGCTGAGCGGGAGAAGGGGATCCTTCAGGAGCTTTTCCTGAAC
AAGGAG---CCTCATGAGCCTGATCCTGAGCCCTATGAACCCGTCCCCCCAAAA----------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------GACCATAGAGGGCCGCCACCTCATGAACACCGTGGCCATGATGGCCCTGGTCACGGAGGAGGGGGCCACCGAGGGCATGATGGAGGCCAC
AACCACGGAGGA---ATGTCAAAGCGCCCCGTTTGTCGACATTTCATGATGAAGGGCAACTGCCGCTACGAGAACAACTGTGCCTTCTACCACCCGGGTG
TCAATGGGCCCCCCCTGCCCTAG


>BGISUSP0000892457
------------------------------------LMKEARKMVSRCTYLNILLQTRSPEILV------------------------------------
--------------------------------------------------------------------------------------APEKKREKPKSLRT
TAPSHAKFRS--LELETPSLVPVKKNASAVVVSDKYNLKPIPLKRQ-SIAALGDAAPPAEKKYKPLNTTPNATKEIKVKIIPPQ-MEGLGFLDALNSAPV
PGIKIKKKKKVLSPTAAK--------------------------EAMDTDRPGTPVPPVEVPELMD--SLEPGALEAKPVESPGDPSQLTRKGRKRKTVT
WPEEGKLREYFYFELDETER-NVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNSQERYIQAEREKGILQELFLN
KE-PHEPDPEPYEPVPPK----------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------DHRGPPPHEHRGHDGPGHGGGGHRGHDGGH
NHGG-MSKRPVCRHFMMKGNCRYENNCAFYHPGVNGPPLP*