Sequences
EST Library Info
cad3Unavailable
eep2Foetus 50 days, epidermis
jej1Small intestine, jejunum
Clusters
Oligos
SNPs

Gene ID ENSG00000137320 (click for geneview)
Transcript ID ENST00000259861(link to ensembl)
Symbol CCHCR1
Localtion Chromosome:6:31218196:31233950:-1 band: 6p21.33
Description Alpha helical coiled-coil rod protein (Putative gene 8 protein) (Pg8).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------><-----------------------------------------------------------------------------------
-M--F--P--P--S--G--S--T--G--L--I--P--P--S--H--F--Q--A--R--P--L--S--T--L--P--R--M--A--P--T--W--L--S--
ATGTTTCCACCTTCAGGTTCCACTGGGCTGATTCCCCCCTCCCACTTTCAAGCTCGGCCCCTTTCAACTCTGCCAAGAATGGCTCCCACCTGGCTCTCAG
                  :::::..::::::: ::::: ::::::::.::::::::::::: :.::::::::::.:::::::::::: :.::: ::::::
------------------TCCACCAGGCTGATACCCCCATCCCACTTCCAAGCTCGGCCCCATCCAACTCTGCCGAGAATGGCTCCCCCTTGGGTCTCAG
-------------------S--T--R--L--I--P--P--S--H--F--Q--A--R--P--H--P--T--L--P--R--M--A--P--P--W--V--S--

----------------------------------------------------------------------------------------------------
D--I--P--L--V--Q--P--P--G--H--Q--D--V--S--E--R--R--L--D--T--Q--R--P--Q--V--T--M--W--E--R--D--V--S--S
ACATTCCCCTGGTCCAACCCCCAGGCCATCAAGATGTCTCAGAGAGGCGGCTAGACACCCAGAGACCTCAAGTGACCATGTGGGAACGGGATGTTTCCAG
::::::::.:::::::.:::::.: ::::::::::::::.:::::::: :..::::: :::::.. :.. :::::::::::::::: .::: :::     
ACATTCCCTTGGTCCAGCCCCCGGCCCATCAAGATGTCTTAGAGAGGCTGTCAGACAACCAGAAGACCTCAGTGACCATGTGGGAAAAGGAAGTT-----
D--I--P--L--V--Q--P--P--A--H--Q--D--V--L--E--R--L--S--D--N--Q--K--T--S--V--T--M--W--E--K--E--V------

-----------------------------><---------------------------------------------------------------------
--D--R--Q--E--P--G--R--R--G--R--S--W--G--L--E--G--S--Q--A--L--S--Q--Q--A--E--V--I--V--R--Q--L--Q--E-
TGACAGGCAGGAGCCAGGGCGGAGAGGCAGGTCCTGGGGGCTGGAGGGGTCACAGGCCCTGAGCCAGCAGGCTGAGGTGATCGTTCGGCAGCTGCAAGAG
                               :::  ::.::::: ::::::.:::::::::::::::::::::::: ::::. .::::::::::::::::
-------------------------------TCCGTGGAGCTGGCGGGGTCGCAGGCCCTGAGCCAGCAGGCTGAGCTGATTTCTCGGCAGCTGCAAGAG
--------------------------------S--V--E--L--A--G--S--Q--A--L--S--Q--Q--A--E--L--I--S--R--Q--L--Q--E-

----------------------------------------------------------------------------------------------------
-L--R--R--L--E--E--E--V--R--L--L--R--E--T--S--L--Q--Q--K--M--R--L--E--A--Q--A--M--E--L--E--A--L--A--
CTGCGGCGGCTGGAGGAGGAGGTCCGGCTCCTGCGGGAGACCTCGCTGCAGCAGAAGATGAGGCTAGAGGCCCAGGCCATGGAGCTAGAGGCTCTGGCAC
::::::::::: ::::::::::::::: : :::::::::::::::::::::::::::::::::::.::: ::::::::::::::::.::::: :::::::
CTGCGGCGGCTCGAGGAGGAGGTCCGGGTGCTGCGGGAGACCTCGCTGCAGCAGAAGATGAGGCTGGAGTCCCAGGCCATGGAGCTGGAGGCGCTGGCAC
-L--R--R--L--E--E--E--V--R--V--L--R--E--T--S--L--Q--Q--K--M--R--L--E--S--Q--A--M--E--L--E--A--L--A--

----------------------------------------------------------------------------------------------------
R--A--E--K--A--G--R--A--E--A--E--G--L--R--A--A--L--A--G--A--E--V--V--R--K--N--L--E--E--G--S--Q--R--E
GGGCGGAGAAGGCCGGCCGAGCTGAGGCTGAGGGCCTGCGTGCTGCTTTGGCTGGGGCTGAGGTTGTCCGGAAGAACTTGGAAGAGGGGAGCCAGCGGGA
::::::::::::::::::: ::::::::.:::::::::::::::::..::::.::::::::::::::::::::::::.::::::::::::::::::::::
GGGCGGAGAAGGCCGGCCGTGCTGAGGCCGAGGGCCTGCGTGCTGCCCTGGCCGGGGCTGAGGTTGTCCGGAAGAACCTGGAAGAGGGGAGCCAGCGGGA
R--A--E--K--A--G--R--A--E--A--E--G--L--R--A--A--L--A--G--A--E--V--V--R--K--N--L--E--E--G--S--Q--R--E

---------------------------------><-----------------------------------------------------------------
--L--E--E--V--Q--R--L--H--Q--E--Q--L--S--S--L--T--Q--A--H--E--E--A--L--S--S--L--T--S--K--A--E--G--L-
GCTGGAAGAGGTTCAGAGGCTGCACCAAGAGCAGCTGTCCTCTTTGACACAGGCTCACGAGGAGGCTCTTTCCAGTTTGACCAGCAAGGCTGAGGGCTTG
::::::.:::::::::::::::::::::::: :::: :::::.::::::::::::::: ::::::::::::::::::::::. .::::::::.::::.::
GCTGGAGGAGGTTCAGAGGCTGCACCAAGAGGAGCTCTCCTCCTTGACACAGGCTCACCAGGAGGCTCTTTCCAGTTTGACTCACAAGGCTGGGGGCCTG
--L--E--E--V--Q--R--L--H--Q--E--E--L--S--S--L--T--Q--A--H--Q--E--A--L--S--S--L--T--H--K--A--G--G--L-

-------------------------------------------------------------------------------------------------><-
-E--K--S--L--S--S--L--E--T--R--R--A--G--E--A--K--E--L--A--E--A--Q--R--E--A--E--L--L--R--K--Q--L--S--
GAGAAGTCTCTGAGTAGTCTGGAAACCAGAAGAGCAGGGGAAGCCAAGGAGCTGGCCGAGGCTCAGAGGGAGGCCGAGCTGCTTCGGAAGCAGCTGAGCA
:::::.:::::::::::::::::::::::.::. :::.::::::::::::::::::.: :::.:::::::::::.:::::::: ::: :::::.::    
GAGAAATCTCTGAGTAGTCTGGAAACCAGGAGGTCAGAGGAAGCCAAGGAGCTGGCTGCGGCCCAGAGGGAGGCTGAGCTGCTGCGGCAGCAGTTG----
-E--K--S--L--S--S--L--E--T--R--R--S--E--E--A--K--E--L--A--A--A--Q--R--E--A--E--L--L--R--Q--Q--L-----

----------------------------------------------------------------------------------------------------
K--T--Q--E--D--L--E--A--Q--V--T--L--V--E--N--L--R--K--Y--V--G--E--Q--V--P--S--E--V--H--S--Q--T--W--E
AGACCCAGGAAGACTTGGAGGCTCAGGTGACCCTGGTTGAGAATCTAAGAAAATATGTTGGGGAACAAGTGCCTTCTGAGGTCCACAGCCAGACATGGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------><-----------------------------------------------------------------
--L--E--R--Q--K--L--L--E--T--M--Q--H--L--Q--E--D--R--D--S--L--H--A--T--A--E--L--L--Q--V--R--V--Q--S-
ACTGGAGCGACAGAAGCTTCTGGAAACCATGCAGCACTTGCAGGAGGACCGGGACAGCCTGCATGCCACCGCGGAGCTGCTGCAGGTGCGGGTGCAGAGC
                                  :: .:::::::::::::::::.: :::::..:::: :: ::::::::::::::::: :::::::::
----------------------------------CAGCTGCAGGAGGACCGGGACGGGCTGCACACCACGGCTGAGCTGCTGCAGGTGCGCGTGCAGAGC
-----------------------------------Q--L--Q--E--D--R--D--G--L--H--T--T--A--E--L--L--Q--V--R--V--Q--S-

--------------------------------------------><------------------------------------------------------
-L--T--H--I--L--A--L--Q--E--E--E--L--T--R--K--V--Q--P--S--D--S--L--E--P--E--F--T--R--K--C--Q--S--L--
CTCACACACATCCTCGCCCTGCAGGAGGAGGAGCTGACCAGGAAGGTTCAACCTTCAGATTCCCTGGAGCCTGAGTTTACCAGGAAGTGCCAGTCCCTGC
:::::.:::::::::  : :.:::::::::::::::.:: : :.::::::.::::::::.: :::::::::.:::::.::::::::::::::: ::::::
CTCACGCACATCCTCTGCATACAGGAGGAGGAGCTGGCCCGCAGGGTTCAGCCTTCAGACTGCCTGGAGCCCGAGTTCACCAGGAAGTGCCAGGCCCTGC
-L--T--H--I--L--C--I--Q--E--E--E--L--A--R--R--V--Q--P--S--D--C--L--E--P--E--F--T--R--K--C--Q--A--L--

-------------------------------------------------------------------------------------------------><-
L--N--R--W--R-----E--K--V--F--A--L--M--V--Q--L--K--A--Q--E--L--E--H--S--D--S--V--K--Q--L--K--G--Q--V
TGAACCGCTGGCGG---GAGAAGGTGTTTGCCCTCATGGTGCAGCTAAAGGCCCAGGAGCTGGAACACAGTGACTCTGTTAAGCAGCTGAAGGGACAGGT
:::: :::::::::   :::::::::::.:::::::::::::::::.:::::::::::::::::.::::: :. : .:: .:::::::::::::::::  
TGAAGCGCTGGCGGA--GAGAAGGTGTTCGCCCTCATGGTGCAGCTGAAGGCCCAGGAGCTGGAGCACAGAGGATGCGTGGAGCAGCTGAAGGGACAG--
L--K--R--W--R--\--E--K--V--F--A--L--M--V--Q--L--K--A--Q--E--L--E--H--R--G--C--V--E--Q--L--K--G--Q---

----------------------------------------------------------------------------------------------------
--A--S--L--Q--E--K--V--T--S--Q--S--Q--E--Q--A--I--L--Q--R--S--L--Q--D--K--A--A--E--V--E--V--E--R--M-
GGCCTCACTCCAGGAAAAAGTGACATCCCAGAGCCAGGAGCAGGCCATCCTGCAGCGATCCCTGCAGGACAAAGCCGCAGAGGTGGAGGTGGAGCGTATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------><------------------------------------------------------------------------------------------
-G--A--K--G--L--Q--L--E--L--S--R--A--Q--E--A--R--R--R--W--Q--Q--Q--T--A--S--A--E--E--Q--L--R--L--V--
GGTGCCAAGGGCCTGCAGTTGGAGCTGAGCCGTGCTCAGGAGGCCAGGCGTCGGTGGCAGCAGCAGACAGCCTCAGCCGAGGAGCAGCTGAGGCTTGTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------><-----------------------------------------------------------------------------------
V--N--A--V--S--S--S--Q--I--W--L--E--T--T--M--A--K--V--E--G--A--A--A--Q--L--P--S--L--N--N--R--L--S--Y
TCAATGCTGTCAGCAGCTCTCAGATCTGGCTCGAGACCACCATGGCTAAGGTGGAAGGGGCTGCCGCCCAGCTTCCCAGCCTCAACAACCGACTCAGCTA
                 :.::::..::::::: ::: :::::::::..:::::::. ::::..: ::::.::: ::::::::::.:. ::: ::::::::
-----------------TTTCAGGCCTGGCTCCAGAGCACCATGGCCGAGGTGGAGCGGGCCACGGCCCGGCTGCCCAGCCTCAGCGCCCGCCTCAGCTA
------------------F--Q--A--W--L--Q--S--T--M--A--E--V--E--R--A--T--A--R--L--P--S--L--S--A--R--L--S--Y

----------------------------><--------------------------------------------><------------------------
--A--V--R--K--V--H--T--I--R--G--L--I--A--R--K--L--A--L--A--Q--L--R--Q--E--S--C--P--L--P--P--P--V--T-
TGCTGTCCGCAAGGTCCACACCATTCGGGGCCTGATTGCTCGAAAGCTTGCCCTTGCTCAGCTGCGCCAGGAGAGCTGTCCCCTACCACCACCGGTCACA
:::.::::: ::::::::::::::::::   .:::: ::::::::.:: ::::::::::::::::::::::::   ::.::::.::: :::::::.::: 
TGCCGTCCGAAAGGTCCACACCATTCGG---TTGATGGCTCGAAAACTGGCCCTTGCTCAGCTGCGCCAGGAG---TGCCCCCCACCCCCACCGGCCACC
--A--V--R--K--V--H--T--I--R-----L--M--A--R--K--L--A--L--A--Q--L--R--Q--E-----C--P--P--P--P--P--A--T-

----------------------------------------------------------------------------------------------------
-D--V--S--L--E--L--Q--Q--L--R--E--E--R--N--R--L--D--A--E--L--Q--L--S--A--R--L--I--Q--Q--E--V--G--R--
GACGTGAGCCTTGAGTTGCAGCAGTTGCGGGAAGAACGGAACCGCCTGGATGCAGAACTGCAGCTGAGTGCCCGCCTCATCCAGCAGGAGGTGGGCCGGG
:: .:::.:::.:::::: :::::.::::::::::.::::::::::::::.:::::::::::::::::.::::.: ::::::::::::::::::::::::
GAGATGAACCTCGAGTTGGAGCAGCTGCGGGAAGAGCGGAACCGCCTGGACGCAGAACTGCAGCTGAGCGCCCACATCATCCAGCAGGAGGTGGGCCGGG
-E--M--N--L--E--L--E--Q--L--R--E--E--R--N--R--L--D--A--E--L--Q--L--S--A--H--I--I--Q--Q--E--V--G--R--

-----------><---------------------------------------------------------------------------------------
A--R--E--Q--G--E--A--E--R--Q--Q--L--S--K--V--A--Q--Q--L--E--Q--E--L--Q--Q--T--Q--E--S--L--A--S--L--G
CTCGGGAGCAAGGGGAGGCAGAGCGGCAGCAGCTGAGCAAGGTGGCCCAGCAGCTGGAGCAGGAGCTGCAGCAGACCCAGGAGTCCCTGGCTAGCTTGGG
:.:::::.:::   ::::..::::::::: ::::::::.:::::::::::::::::::::::::::::::::. :: ::::::::::::::.::.:::::
CCCGGGAACAA---GAGGTGGAGCGGCAGAAGCTGAGCGAGGTGGCCCAGCAGCTGGAGCAGGAGCTGCAGCGCACACAGGAGTCCCTGGCCAGTTTGGG
A--R--E--Q-----E--V--E--R--Q--K--L--S--E--V--A--Q--Q--L--E--Q--E--L--Q--R--T--Q--E--S--L--A--S--L--G

----------------------------------------------------------------------------------------------------
--L--Q--L--E--V--A--R--Q--G--Q--Q--E--S--T--E--E--A--A--S--L--R--Q--E--L--T--Q--Q--Q--E--L--Y--G--Q-
GCTGCAGCTGGAGGTAGCACGCCAGGGCCAGCAGGAGAGCACAGAGGAGGCTGCCAGTCTGCGGCAGGAGCTGACCCAGCAGCAGGAACTCTACGGGCAA
::::::::::::::.::: ::::::::::::::.:::.::::.: :::::::::..:::: ::::::::::::::::::::::::::. ::::.::::::
GCTGCAGCTGGAGGCAGCTCGCCAGGGCCAGCAAGAGGGCACGGCGGAGGCTGCTGGTCTCCGGCAGGAGCTGACCCAGCAGCAGGAGATCTATGGGCAA
--L--Q--L--E--A--A--R--Q--G--Q--Q--E--G--T--A--E--A--A--G--L--R--Q--E--L--T--Q--Q--Q--E--I--Y--G--Q-

><--------------------------------------------------------------------------------------------------
-A--L--Q--E--K--V--A--E--V--E--T--R--L--R--E--Q--L--S--D--T--E--R--R--L--N--E--A--R--R--E--H--A--K--
GCCCTGCAAGAAAAGGTGGCTGAAGTGGAAACTCGGCTGCGGGAGCAACTCTCAGACACAGAGAGGAGGCTGAACGAGGCTCGGAGGGAGCATGCCAAGG
   :::::.::.::::::::.:::::::::::::::::::::::.::.::::::::  ::::.:::::.:::::.::::::::::::::.::..::::: 
---CTGCAGGAGAAGGTGGCCGAAGTGGAAACTCGGCTGCGGGAACAGCTCTCAGAGTCAGAAAGGAGACTGAATGAGGCTCGGAGGGAACACACCAAG-
----L--Q--E--K--V--A--E--V--E--T--R--L--R--E--Q--L--S--E--S--E--R--R--L--N--E--A--R--R--E--H--T--K--

--><------------------------------------------------------------------------------------------------
A--V--V--S--L--R--Q--I--Q--R--R--A--A--Q--E--K--E--R--S--Q--E--L--R--R--L--Q--E--E--A--R--K--E--E--G
CCGTGGTCTCCTTACGCCAGATTCAGCGCAGAGCCGCCCAGGAAAAGGAGCGGAGCCAGGAACTCAGGCGTCTGCAGGAGGAGGCCCGGAAGGAGGAGGG
     ::::::.:.:::::::: :::::::.::::.:::.:::.::::::::::.::::::.::: ::::.:::::::::::::::::.:::::::::::
-----GTCTCCCTGCGCCAGATGCAGCGCAAAGCCACCCGGGAGAAGGAGCGGAACCAGGAGCTCCGGCGCCTGCAGGAGGAGGCCCGAAAGGAGGAGGG
------V--S--L--R--Q--M--Q--R--K--A--T--R--E--K--E--R--N--Q--E--L--R--R--L--Q--E--E--A--R--K--E--E--G

------------------------------------------------------><--------------------------------------------
--Q--R--L--A--R--R--L--Q--E--L--E--R--D--K--N--L--M--L--A--T--L--Q--Q--E--G--L--L--S--R--Y--K--Q--Q-
GCAGCGACTGGCCCGGCGCTTGCAGGAGCTAGAGAGGGATAAGAACCTCATGCTGGCCACCTTGCAGCAGGAAGGTCTCCTCTCCCGTTACAAGCAGCAG
::::::.:::.:::.::::.:: :::::::.::::::::.::::::::::::.:::::::::::::::::::.::::::::::::::::::::::::::.
GCAGCGGCTGACCCAGCGCCTGAAGGAGCTGGAGAGGGACAAGAACCTCATGTTGGCCACCTTGCAGCAGGAGGGTCTCCTCTCCCGTTACAAGCAGCAA
--Q--R--L--T--Q--R--L--K--E--L--E--R--D--K--N--L--M--L--A--T--L--Q--Q--E--G--L--L--S--R--Y--K--Q--Q-

----------------------------------------------------------------------------------------------------
-R--L--L--T--V--L--P--S--L--L--D--K--K--K--S--V--V--S--S--P--R--P--P--E--C--S--A--S--A--P--V--A--A--
CGACTGTTGACAGTTCTTCCTTCCCTACTGGATAAGAAGAAATCTGTGGTGTCCAGCCCCAGGCCTCCAGAGTGTTCAGCATCTGCACCTGTAGCAGCAG
:::::::::.::::::::::::::::..::::::::..::::.:::::: :::..:::: .::  .:: :::: ::::::..::::.::: :.::::..:
CGACTGTTGGCAGTTCTTCCTTCCCTGTTGGATAAGGGGAAACCTGTGGAGTCTGGCCCAGGGAACCCTGAGTCTTCAGCGCCTGCGCCTCTGGCAGTGG
-R--L--L--A--V--L--P--S--L--L--D--K--G--K--P--V--E--S--G--P--G--N--P--E--S--S--A--P--A--P--L--A--V--

--------------------------><------------------------------------------------------------------------
A--V--P--T--R--E--S--I--K--G--S--L--S--V--L--L--D--D--L--Q--D--L--S--E--A--I--S--K--E--E--A--V--C--Q
CAGTGCCCACCAGGGAGTCCATAAAAGGGTCCCTCTCTGTCCTGCTCGATGACCTGCAGGACCTGAGTGAAGCCATTTCCAAAGAGGAAGCTGTTTGTCA
:    . :::::.::::::::: :.:   ::::::::.: :::::: :::::::::::::.:::::::::.:::::::::::::::::.::: ::::: :
CCCGCTGCACCAAGGAGTCCATCAGA---TCCCTCTCCGACCTGCTGGATGACCTGCAGGGCCTGAGTGAGGCCATTTCCAAAGAGGAGGCTCTTTGTGA
A--R--C--T--K--E--S--I--R-----S--L--S--D--L--L--D--D--L--Q--G--L--S--E--A--I--S--K--E--E--A--L--C--E

--------------------------------------------------->
--G--D--N--L--D--R--C--S--S--S--N--P--Q--M--S--S--*-
AGGAGACAACCTTGACAGATGCTCCAGCTCCAATCCCCAGATGAGCAGCTAA
:::::: :::                                          
AGGAGAGAAC------------------------------------------
--G--E--N-------------------------------------------

Pig Consensus Sequence

>BGISUST0000883685
------------------TCCACCAGGCTGATACCCCCATCCCACTTCCAAGCTCGGCCCCATCCAACTCTGCCGAGAATGGCTCCCCCTTGGGTCTCAG
ACATTCCCTTGGTCCAGCCCCCGGCCCATCAAGATGTCTTAGAGAGGCTGTCAGACAACCAGAAGACCTCAGTGACCATGTGGGAAAAGGAAGTT-----
-------------------------------TCCGTGGAGCTGGCGGGGTCGCAGGCCCTGAGCCAGCAGGCTGAGCTGATTTCTCGGCAGCTGCAAGAG
CTGCGGCGGCTCGAGGAGGAGGTCCGGGTGCTGCGGGAGACCTCGCTGCAGCAGAAGATGAGGCTGGAGTCCCAGGCCATGGAGCTGGAGGCGCTGGCAC
GGGCGGAGAAGGCCGGCCGTGCTGAGGCCGAGGGCCTGCGTGCTGCCCTGGCCGGGGCTGAGGTTGTCCGGAAGAACCTGGAAGAGGGGAGCCAGCGGGA
GCTGGAGGAGGTTCAGAGGCTGCACCAAGAGGAGCTCTCCTCCTTGACACAGGCTCACCAGGAGGCTCTTTCCAGTTTGACTCACAAGGCTGGGGGCCTG
GAGAAATCTCTGAGTAGTCTGGAAACCAGGAGGTCAGAGGAAGCCAAGGAGCTGGCTGCGGCCCAGAGGGAGGCTGAGCTGCTGCGGCAGCAGTTG----
----------------------------------------------------------------------------------------------------
----------------------------------CAGCTGCAGGAGGACCGGGACGGGCTGCACACCACGGCTGAGCTGCTGCAGGTGCGCGTGCAGAGC
CTCACGCACATCCTCTGCATACAGGAGGAGGAGCTGGCCCGCAGGGTTCAGCCTTCAGACTGCCTGGAGCCCGAGTTCACCAGGAAGTGCCAGGCCCTGC
TGAAGCGCTGGCGggAGAAGGTGTTCGCCCTCATGGTGCAGCTGAAGGCCCAGGAGCTGGAGCACAGAGGATGCGTGGAGCAGCTGAAGGGACAG-----
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------TTTCAGGCCTGGCTCCAGAGCACCATGGCCGAGGTGGAGCGGGCCACGGCCCGGCTGCCCAGCCTCAGCGCCCGCCTCAGCTATGC
CGTCCGAAAGGTCCACACCATTCGG---TTGATGGCTCGAAAACTGGCCCTTGCTCAGCTGCGCCAGGAG---TGCCCCCCACCCCCACCGGCCACCGAG
ATGAACCTCGAGTTGGAGCAGCTGCGGGAAGAGCGGAACCGCCTGGACGCAGAACTGCAGCTGAGCGCCCACATCATCCAGCAGGAGGTGGGCCGGGCCC
GGGAACAA---GAGGTGGAGCGGCAGAAGCTGAGCGAGGTGGCCCAGCAGCTGGAGCAGGAGCTGCAGCGCACACAGGAGTCCCTGGCCAGTTTGGGGCT
GCAGCTGGAGGCAGCTCGCCAGGGCCAGCAAGAGGGCACGGCGGAGGCTGCTGGTCTCCGGCAGGAGCTGACCCAGCAGCAGGAGATCTATGGGCAA---
CTGCAGGAGAAGGTGGCCGAAGTGGAAACTCGGCTGCGGGAACAGCTCTCAGAGTCAGAAAGGAGACTGAATGAGGCTCGGAGGGAACACACCAAG----
--GTCTCCCTGCGCCAGATGCAGCGCAAAGCCACCCGGGAGAAGGAGCGGAACCAGGAGCTCCGGCGCCTGCAGGAGGAGGCCCGAAAGGAGGAGGGGCA
GCGGCTGACCCAGCGCCTGAAGGAGCTGGAGAGGGACAAGAACCTCATGTTGGCCACCTTGCAGCAGGAGGGTCTCCTCTCCCGTTACAAGCAGCAACGA
CTGTTGGCAGTTCTTCCTTCCCTGTTGGATAAGGGGAAACCTGTGGAGTCTGGCCCAGGGAACCCTGAGTCTTCAGCGCCTGCGCCTCTGGCAGTGGCCC
GCTGCACCAAGGAGTCCATCAGA---TCCCTCTCCGACCTGCTGGATGACCTGCAGGGCCTGAGTGAGGCCATTTCCAAAGAGGAGGCTCTTTGTGAAGG
AGAGAAC------------------------------------------


>BGISUSP0000883685
------STRLIPPSHFQARPHPTLPRMAPPWVSDIPLVQPPAHQDVLERLSDNQKTSVTMWEKEV------------SVELAGSQALSQQAELISRQLQE
LRRLEEEVRVLRETSLQQKMRLESQAMELEALARAEKAGRAEAEGLRAALAGAEVVRKNLEEGSQRELEEVQRLHQEELSSLTQAHQEALSSLTHKAGGL
EKSLSSLETRRSEEAKELAAAQREAELLRQQL----------------------------------------------QLQEDRDGLHTTAELLQVRVQS
LTHILCIQEEELARRVQPSDCLEPEFTRKCQALLKRWREKVFALMVQLKAQELEHRGCVEQLKGQ-----------------------------------
--------------------------------------FQAWLQSTMAEVERATARLPSLSARLSYAVRKVHTIR-LMARKLALAQLRQE-CPPPPPATE
MNLELEQLREERNRLDAELQLSAHIIQQEVGRAREQ-EVERQKLSEVAQQLEQELQRTQESLASLGLQLEAARQGQQEGTAEAAGLRQELTQQQEIYGQ-
LQEKVAEVETRLREQLSESERRLNEARREHTK--VSLRQMQRKATREKERNQELRRLQEEARKEEGQRLTQRLKELERDKNLMLATLQQEGLLSRYKQQR
LLAVLPSLLDKGKPVESGPGNPESSAPAPLAVARCTKESIR-SLSDLLDDLQGLSEAISKEEALCEGEN--------------