Sequences
EST Library Info
cad1Unavailable
cbr4Brain - RNA from China
csp2Spleen - RNA from China
ecc1Foetus 50 days, cortex cerebri
mcp2Mammae, collostrum producing
Clusters
Oligos
SNPs

Gene ID ENSG00000137321 (click for geneview)
Transcript ID ENST00000259862(link to ensembl)
Symbol RPP21
Localtion Chromosome:6:30420925:30422649:1 band: 6p21.33
Description Ribonuclease P protein subunit p21 (EC 3.1.26.5) (RNaseP protein p21) (Ribonucleoprotein V).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------><------------------------------------------
-M--A--G--P--V--K--D--R--E--A--F--Q--R--L--N--F--L--Y--Q--A--A--H--C--V--L--A--Q--D--P--E--N--Q--A--
ATGGCGGGGCCGGTGAAGGACCGCGAGGCCTTCCAGAGGCTCAACTTCCTGTACCAGGCCGCCCATTGTGTCCTTGCCCAGGACCCCGAGAACCAGGCGC
:::::::::: :::::::::::::::::::::::::::.::::.::::.::::.::::::::::::::.::.::.:: :::::::: :::::::::::::
ATGGCGGGGCAGGTGAAGGACCGCGAGGCCTTCCAGAGACTCAGCTTCTTGTATCAGGCCGCCCATTGCGTTCTCGCGCAGGACCCGGAGAACCAGGCGC
-M--A--G--Q--V--K--D--R--E--A--F--Q--R--L--S--F--L--Y--Q--A--A--H--C--V--L--A--Q--D--P--E--N--Q--A--

---------------------------------------------------------><-----------------------------------------
L--A--R--F--Y--C--Y--T--E--R--T--I--A--K--R--L--V--L--R--R--D--P--S--V--K--R--T--L--C--R--G--C--S--S
TGGCGAGGTTTTACTGCTACACTGAGAGGACCATTGCGAAGCGGCTCGTCTTGCGGCGGGATCCCTCGGTGAAGAGGACTCTCTGTCGAGGCTGCTCTTC
:.:::::::::::::::.:::: ::::::::::: :::::::::::::::::::::   ::.:::::::::::::::::.:::::.:: :::::::::::
TAGCGAGGTTTTACTGCCACACGGAGAGGACCATAGCGAAGCGGCTCGTCTTGCGG---GACCCCTCGGTGAAGAGGACCCTCTGCCGTGGCTGCTCTTC
L--A--R--F--Y--C--H--T--E--R--T--I--A--K--R--L--V--L--R-----D--P--S--V--K--R--T--L--C--R--G--C--S--S

----------------------------------------><----------------------------------------------------------
--L--L--V--P--G--L--T--C--T--Q--R--Q--R--R--C--R--G--Q--R--W--T--V--Q--T--C--L--T--C--Q--R--S--Q--R-
CCTCCTCGTCCCGGGCCTCACCTGCACCCAGCGCCAGAGACGCTGCAGGGGACAGCGCTGGACCGTACAGACCTGCCTAACATGCCAGCGCAGCCAACGC
:::::::.:.:::::::: :::::::::::::::::: ::   ::::.::: :::::::::::.::::::::::::::::::::::::::::::::.:: 
CCTCCTCATTCCGGGCCTGACCTGCACCCAGCGCCAGCGA---TGCAAGGGTCAGCGCTGGACTGTACAGACCTGCCTAACATGCCAGCGCAGCCAGCGG
--L--L--I--P--G--L--T--C--T--Q--R--Q--R-----C--K--G--Q--R--W--T--V--Q--T--C--L--T--C--Q--R--S--Q--R-

------------------------------------------------------------------><--------------------------------
-F--L--N--D--P--G--H--L--L--W--G--D--R--P--E--A--Q--L--G--S--Q--A--D--S--K--P--L--Q--P--L--P--N--T--
TTCCTCAATGATCCCGGGCATTTACTCTGGGGAGACAGGCCTGAGGCCCAGCTCGGGAGCCAAGCAGATTCCAAACCACTACAACCCTTGCCAAACACAG
::::::::.:::::..:::::.:.:::::::: ::: :::::::::::::::: ::::::::.      .::: :::::.:::.:::. :::::::::::
TTCCTCAACGATCCTAGGCATCTGCTCTGGGGCGACCGGCCTGAGGCCCAGCTAGGGAGCCAG------CCCACACCACCACAGCCCCAGCCAAACACAG
-F--L--N--D--P--R--H--L--L--W--G--D--R--P--E--A--Q--L--G--S--Q--------P--T--P--P--Q--P--Q--P--N--T--

------------------------------------------------------------------->
A-----H--S--I--S--D--R--L--P--E--E--K--M--Q--T--Q--G--S--S--N--Q--*-
CC---CACTCCATTTCAGACCGCCTTCCTGAGGAGAAAATGCAGACTCAGGGTTCCAGTAACCAGTGA
::   .::.::::..:::.::.::::::::::::::::.::::: :::::.:.:::::: ::::::::
CCA--TACCCCATCCCAGGCCACCTTCCTGAGGAGAAAGTGCAGCCTCAGAGCTCCAGTCACCAGTGA
A--\--Y--P--I--P--G--H--L--P--E--E--K--V--Q--P--Q--S--S--S--H--Q--*-

Pig Consensus Sequence

>BGISUST0000876359
ATGGCGGGGCAGGTGAAGGACCGCGAGGCCTTCCAGAGACTCAGCTTCTTGTATCAGGCCGCCCATTGCGTTCTCGCGCAGGACCCGGAGAACCAGGCGC
TAGCGAGGTTTTACTGCCACACGGAGAGGACCATAGCGAAGCGGCTCGTCTTGCGG---GACCCCTCGGTGAAGAGGACCCTCTGCCGTGGCTGCTCTTC
CCTCCTCATTCCGGGCCTGACCTGCACCCAGCGCCAGCGA---TGCAAGGGTCAGCGCTGGACTGTACAGACCTGCCTAACATGCCAGCGCAGCCAGCGG
TTCCTCAACGATCCTAGGCATCTGCTCTGGGGCGACCGGCCTGAGGCCCAGCTAGGGAGCCAG------CCCACACCACCACAGCCCCAGCCAAACACAG
CctACCCCATCCCAGGCCACCTTCCTGAGGAGAAAGTGCAGCCTCAGAGCTCCAGTCACCAGTGA


>BGISUSP0000876359
MAGQVKDREAFQRLSFLYQAAHCVLAQDPENQALARFYCHTERTIAKRLVLR-DPSVKRTLCRGCSSLLIPGLTCTQRQR-CKGQRWTVQTCLTCQRSQR
FLNDPRHLLWGDRPEAQLGSQ--PTPPQPQPNTAYPIPGHLPEEKVQPQSSSHQ*