Sequences
EST Library Info
cga2Galactophore - RNA from China
cly3Lymph - RNA from China
cov1Ovary - RNA from China
ebs2Foetus 50 days, brain stem
ece2Foetus 50 days, cerebellum
eep3Foetus 50 days, epidermis
eye2Foetus 50 days, Eye
med2Mediastinum
nje1Newborn 115 days, jejunum
pigca2Unavailable
plac3Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000137324 (click for geneview)
Transcript ID ENST00000259865(link to ensembl)
Symbol BAT8_HUMAN
Localtion Chromosome:6:31955521:31973433:-1 band: 6p21.33
Description Histone-lysine N-methyltransferase, H3 lysine-9 specific 3 (EC 2.1.1.43) (Histone H3-K9 methyltransferase 3) (H3-K9-HMTase 3) (HLA-B associated transcript 8) (G9a protein) (NG36). [Source:Uniprot/SWISSPROT;Acc:Q96KQ7]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------><---------------------------------------------------------
-M--A--A--A--A--G--A--A--A--A--A--A--A--E--G--E--A--P--A--E--M--G--A--L--L--L--E--K--E--T--R--G--A--
ATGGCGGCGGCGGCGGGAGCTGCAGCGGCGGCGGCCGCCGAGGGGGAGGCCCCCGCTGAGATGGGGGCGCTGCTGCTGGAGAAGGAAACCAGAGGAGCCA
                                          :::::::::::::::::::::::::::::: :::::::::::::. ::::::::::.:
------------------------------------------GGGGAGGCCCCCGCTGAGATGGGGGCGCTGGTGCTGGAGAAGGAGCCCAGAGGAGCTA
-------------------------------------------G--E--A--P--A--E--M--G--A--L--V--L--E--K--E--P--R--G--A--

--------><------------------------------------------------------------------------------------------
T--E--R--V--H--G--S--L--G--D--T--P--R--S--E--E--T--L--P--K--A--T--P--D--S--L--E--P--A--G--P--S--S--P
CCGAGAGAGTTCATGGCTCTTTGGGGGACACCCCTCGTAGTGAAGAAACCCTGCCCAAGGCCACCCCCGACTCCCTGGAGCCTGCTGGCCCCTCATCTCC
::::::::   ::::::::::::::::::::::::::::::::.::..:::: :::::::::: :::.:::::::::::.:::::::::::::::::.::
CCGAGAGA---CATGGCTCTTTGGGGGACACCCCTCGTAGTGAGGAGGCCCTCCCCAAGGCCAACCCTGACTCCCTGGAACCTGCTGGCCCCTCATCCCC
T--E--R-----H--G--S--L--G--D--T--P--R--S--E--E--A--L--P--K--A--N--P--D--S--L--E--P--A--G--P--S--S--P

----------------------------------------------------------------------------------------------------
--A--S--V--T--V--T--V--G--D--E--G--A--D--T--P--V--G--A--T--P--L--I--G--D--E--S--E--N--L--E--G--D--G-
AGCCTCTGTCACTGTCACTGTTGGTGATGAGGGGGCTGACACCCCTGTAGGGGCTACACCACTCATTGGGGATGAATCTGAGAATCTTGAGGGAGATGGG
:::::::::::: :::::.::.::.::::::::.::::::::.:::.:::::::.::::: :::::::::::::::.:.::::::::.::::::::::::
AGCCTCTGTCACAGTCACCGTCGGCGATGAGGGAGCTGACACTCCTATAGGGGCCACACCTCTCATTGGGGATGAACCCGAGAATCTCGAGGGAGATGGG
--A--S--V--T--V--T--V--G--D--E--G--A--D--T--P--I--G--A--T--P--L--I--G--D--E--P--E--N--L--E--G--D--G-

---------------------------><-----------------------------------------------------------------------
-D--L--R--G--G--R--I--L--L--G--H--A--T--K--S--F--P--S--S--P--S--K--G--G--S--C--P--S--R--A--K--M--S--
GACCTCCGTGGGGGCCGGATCCTGCTGGGCCATGCCACAAAGTCATTCCCCTCTTCCCCCAGCAAGGGGGGTTCCTGTCCTAGCCGGGCCAAGATGTCAA
:::::::.:::::: :: :::::::::   :::::::::::::::::::: ::::::::.:::::::::::: :::::::.::: :.:::::.:::::::
GACCTCCATGGGGGACGCATCCTGCTG---CATGCCACAAAGTCATTCCCGTCTTCCCCTAGCAAGGGGGGTGCCTGTCCCAGCAGAGCCAAAATGTCAA
-D--L--H--G--G--R--I--L--L-----H--A--T--K--S--F--P--S--S--P--S--K--G--G--A--C--P--S--R--A--K--M--S--

----------------------------------------------------------------------------------------------------
M--T--G--A--G--K--S--P--P--S--V--Q--S--L--A--M--R--L--L--S--M--P--G--A--Q--G--A--A--A--A--G-----S--E
TGACAGGGGCGGGAAAATCACCTCCATCTGTCCAGAGTTTGGCTATGAGGCTACTGAGTATGCCAGGAGCCCAGGGAGCTGCAGCAGCAGGG---TCTGA
:::: ::::: :::::::::::.::::: :::::::::::::::::::::::.:::::::::::.::.::::::::.:: :::::::::: .   .::::
TGACTGGGGCTGGAAAATCACCCCCATCAGTCCAGAGTTTGGCTATGAGGCTGCTGAGTATGCCGGGGGCCCAGGGGGCAGCAGCAGCAGCAATACCTGA
M--T--G--A--G--K--S--P--P--S--V--Q--S--L--A--M--R--L--L--S--M--P--G--A--Q--G--A--A--A--A--A--I--P--E

------------------------------------------------------------------------------------><--------------
--P--P--P--A--T--T--S--P--E--G--Q--P--K--V--H--R--A--R--K--T--M--S--K--P--G--N--G--Q--P--P--V--P--E-
ACCCCCTCCAGCCACCACGAGCCCAGAGGGACAGCCCAAGGTCCACCGAGCCCGCAAAACCATGTCCAAACCAGGAAATGGACAGCCCCCGGTCCCTGAG
::::::::::::::: .: :::::::::::.::::::::::::::.:::::: : ::.::::::::.:::::.                           
ACCCCCTCCAGCCACAGCCAGCCCAGAGGGGCAGCCCAAGGTCCATCGAGCCAGGAAGACCATGTCTAAACCG---------------------------
--P--P--P--A--T--A--S--P--E--G--Q--P--K--V--H--R--A--R--K--T--M--S--K--P----------------------------

---------------------------------------------------------------------><-----------------------------
-K--R--P--P--E--I--Q--H--F--R--M--S--D--D--V--H--S--L--G--K--V--T--S--D--L--A--K--R--R--K--L--N--S--
AAGCGGCCCCCTGAAATACAGCATTTCCGCATGAGTGATGATGTCCACTCACTGGGAAAGGTGACCTCAGATCTGGCCAAAAGGAGGAAGCTGAACTCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------><----------------------------------------------------------------------------------------
G--G--G--L--S--E--E--L--G--S--A--R--R--S--G--E--V--T--L--T--K--G--D--P--G--S--L--E--E--W--E--T--V--V
GAGGTGGCCTGTCAGAGGAGTTAGGTTCTGCCCGGCGTTCAGGAGAAGTGACCCTGACGAAAGGGGACCCCGGGTCCCTGGAGGAGTGGGAGACGGTGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------><--------------------------------
--G--D--D--F--S--L--Y--Y--D--S--Y--S--V--D--E--R--V--D--S--D--S--K--S--E--V--E--A--L--T--E--Q--L--S-
GGGTGATGACTTCAGTCTCTACTATGATTCCTACTCTGTGGATGAGCGCGTGGACTCCGACAGCAAGTCTGAAGTTGAAGCTCTAACTGAACAACTAAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--E--D--E--E--S--G--N--Q--S--D--
GAAGAGGAGGAGGAGGAAGAGGAGGAAGAAGAAGAAGAGGAAGAGGAGGAGGAAGAGGAAGAAGAAGAGGAAGATGAGGAGTCAGGGAATCAGTCAGATA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-><-------------------------------------------------------------------------------------------------
R--S--G--S--S--G--R--R--K--A--K--K--K--W--R--K--D--S--P--W--V--K--P--S--R--K--R--R--K--R--E--P--P--R
GGAGTGGTTCCAGTGGCCGGCGCAAGGCCAAGAAGAAATGGCGAAAAGACAGCCCATGGGTGAAGCCGTCTCGGAAACGGCGCAAGCGGGAGCCTCCGCG
     ::::::::.:::::::::::.:::::::::::.:::::.::.:::::.::.:::::::::::::: ::::::::::: ::::::::::::::: :
-----GGTTCCAGCGGCCGGCGCAAAGCCAAGAAGAAGTGGCGGAAGGACAGTCCGTGGGTGAAGCCGTCACGGAAACGGCGGAAGCGGGAGCCTCCGAG
------G--S--S--G--R--R--K--A--K--K--K--W--R--K--D--S--P--W--V--K--P--S--R--K--R--R--K--R--E--P--P--R

----------------><----------------------------------------------------------------------------------
--A--K--E--P--R--G--V--N--G--V--G--S--S--G--P--S--E--Y--M--E--V--P--L--G--S--L--E--L--P--S--E--G--T-
GGCCAAGGAGCCACGAGGAGTGAATGGTGTGGGCTCCTCAGGCCCCAGTGAGTACATGGAGGTCCCTCTGGGGTCCCTGGAGCTGCCCAGCGAGGGGACC
::::::.:::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGCCAAAGAGCCACGA---GTGAATGGTGTGGGCTCCTCAGGCCCCAGTGAGTACATGGAGGTCCCTCTGGGGTCCCTGGAGCTGCCCAGCGAGGGGACC
--A--K--E--P--R-----V--N--G--V--G--S--S--G--P--S--E--Y--M--E--V--P--L--G--S--L--E--L--P--S--E--G--T-

------------------><--------------------------------------------------------------------------------
-L--S--P--N--H--A--G--V--S--N--D--T--S--S--L--E--T--E--R--G--F--E--E--L--P--L--C--S--C--R--M--E--A--
CTCTCCCCCAACCACGCTGGGGTGTCCAATGACACATCTTCGCTGGAGACAGAGCGAGGGTTTGAGGAGTTGCCCCTGTGCAGCTGCCGCATGGAGGCAC
:::::.::::::::::::                                                      ::::: ::  . :::::::: : .::::
CTCTCTCCCAACCACGCT------------------------------------------------------CCCCTCTG-CANTGCCGCAT-GNAGCAC
-L--S--P--N--H--A--------------------------------------------------------P--L--C--X--C--R--M--X--A--

-------------------------------------------------------------------------><-------------------------
P--K--I--D--R--I--S--E--R--A--G--H--K--C--M--A--T--E--S--V--D--G--E--L--S--G--C--N--A--A--I--L--K--R
CCAAGATTGACCGCATCAGCGAGAGGGCGGGGCACAAGTGCATGGCCACTGAGAGTGTGGACGGAGAGCTGTCAGGCTGCAATGCCGCCATCCTCAAGCG
::::::: :::::::::::.:::::.:::: :::::::::::::::::: :::::::::::.::::::::.::.::::::::.::::: :::::::::::
CCAAGATAGACCGCATCAGTGAGAGAGCGGNGCACAAGTGCATGGCCACGGAGAGTGTGGATGGAGAGCTATCGGGCTGCAACGCCGCGATCCTCAAGCG
P--K--I--D--R--I--S--E--R--A--X--H--K--C--M--A--T--E--S--V--D--G--E--L--S--G--C--N--A--A--I--L--K--R

----------------------------------------------------------------------------------------------------
--E--T--M--R--P--S--S--R--V--A--L--M--V--L--C--E--T--H--R--A--R--M--V--K--H--H--C--C--P--G--C--G--Y-
GGAGACCATGAGGCCATCCAGCCGTGTGGCCCTGATGGTGCTCTGTGAGACCCACCGCGCCCGCATGGTCAAACACCACTGCTGCCCGGGCTGCGGCTAC
::::::::::::.::.:: :::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.::::::
GGAGACCATGAGACCGTCGAGCCGCGTGGCCCTGATGGTGCTCTGTGAGACCCACCGCGCCCGCATGGTCAAACACCACTGCTGCCCAGGCTGTGGCTAC
--E--T--M--R--P--S--S--R--V--A--L--M--V--L--C--E--T--H--R--A--R--M--V--K--H--H--C--C--P--G--C--G--Y-

-----------------><---------------------------------------------------------------------------------
-F--C--T--A--G--T--F--L--E--C--H--P--D--F--R--V--A--H--R--F--H--K--A-----C--V--S--Q--L--N--G--M--V--
TTCTGCACGGCGGGCACCTTCCTGGAGTGCCACCCTGACTTCCGTGTGGCCCACCGCTTCCACAAGGCC---TGTGTGTCTCAGCTGAATGGGATGGTCT
:::::.:::::::::::::::::::::::::::::.:::::::: ::::::::::::::::::::::::    :.:::::.::::: ::.::::::::::
TTCTGTACGGCGGGCACCTTCCTGGAGTGCCACCCCGACTTCCGAGTGGCCCACCGCTTCCACAAGGCCT--GGCGTGTCCCAGCTCAACGGGATGGTCT
-F--C--T--A--G--T--F--L--E--C--H--P--D--F--R--V--A--H--R--F--H--K--A--\--C--V--S--Q--L--N--G--M--V--

----------------------------------------------------------------------------------------------------
F--C--P--H--C--G--E--D--A--S--E--A--Q--E--V--T--I--P--R--G--D--G--V--T--P--P--A--G--T--A--A--P--A--P
TCTGTCCCCACTGTGGGGAGGATGCTTCTGAAGCTCAAGAGGTGACCATCCCCCGGGGTGACGGGGTGACCCCACCGGCCGGCACTGCAGCTCCTGCACC
::::::::::::::::::::::.:: :::::.::.::::::::::::::::::::::: ::.::::::::::::::.:: :::::::::::.::.:: ::
TCTGTCCCCACTGTGGGGAGGACGCATCTGAGGCCCAAGAGGTGACCATCCCCCGGGGGGATGGGGTGACCCCACCAGCGGGCACTGCAGCCCCCGCCCC
F--C--P--H--C--G--E--D--A--S--E--A--Q--E--V--T--I--P--R--G--D--G--V--T--P--P--A--G--T--A--A--P--A--P

--------------------------------------------------------><------------------------------------------
--P--P--L--S--Q--D--V--P--G--R--A--D--T--S--Q--P--S--A--R--M--R--G--H--G--E--P--R--R--P--P--C--D--P-
CCCACCCCTGTCCCAGGATGTCCCCGGGAGAGCAGACACTTCTCAGCCCAGTGCCCGGATGCGAGGGCATGGGGAACCCCGGCGCCCGCCCTGCGATCCC
:::::::::: : :::::::.::::::::::::.::::::::.::::::   :::::::::::::: ::.:::::.:::::::: :: ::::::::.:::
CCCACCCCTGGCACAGGATGCCCCCGGGAGAGCGGACACTTCCCAGCCC---GCCCGGATGCGAGGTCACGGGGAGCCCCGGCGGCCCCCCTGCGACCCC
--P--P--L--A--Q--D--A--P--G--R--A--D--T--S--Q--P-----A--R--M--R--G--H--G--E--P--R--R--P--P--C--D--P-

----------------------------------------------------------------------------------------------------
-L--A--D--T--I--D--S--S--G--P--S--L-----T--L-----P--N--G--G--C--L--S--A--V--G--L--P--L--G--P--G--R--
CTGGCTGACACCATTGACAGCTCAGGGCCCTCCCTG---ACCCTG---CCCAATGGGGGCTGCCTTTCAGCCGTGGGGCTGCCACTGGGGCCAGGCCGGG
::::::::::::::.::::::::.::::::::::::   ::::::   ::::.:::.::::::::.:::: .:::::::::::::. :::::::::::::
CTGGCTGACACCATCGACAGCTCGGGGCCCTCCCTGC--ACCCTGG--CCCAGTGGAGGCTGCCTCTCAGATGTGGGGCTGCCACCTGGGCCAGGCCGGG
-L--A--D--T--I--D--S--S--G--P--S--L--\--T--L--\--P--S--G--G--C--L--S--D--V--G--L--P--P--G--P--G--R--

---------------------------------------------><-----------------------------------------------------
E--A--L--E--K--A--L--V--I--Q--E--S--E--R--R--K--K--L--R--F--H--P--R--Q--L--Y--L--S--V--K--Q--G--E--L
AGGCCCTGGAAAAGGCCCTGGTCATCCAGGAGTCAGAGAGGCGGAAGAAGCTCCGTTTCCACCCTCGGCAGTTGTACCTGTCCGTGAAGCAGGGCGAGCT
::::::::::.::::: :::::::::::::::::.:::   ::::::::.::::::::::::::.::::::.:::::::::: :::::::::::::::::
AGGCCCTGGAGAAGGCACTGGTCATCCAGGAGTCGGAG---CGGAAGAAACTCCGTTTCCACCCCCGGCAGCTGTACCTGTCAGTGAAGCAGGGCGAGCT
E--A--L--E--K--A--L--V--I--Q--E--S--E-----R--K--K--L--R--F--H--P--R--Q--L--Y--L--S--V--K--Q--G--E--L

----------------------------><----------------------------------------------------------------------
--Q--K--V--I--L--M--L--L--D--N--L--D--P--N--F--Q--S--D--Q--Q--S--K--R--T--P--L--H--A--A--A--Q--K--G-
GCAGAAGGTGATCCTGATGCTGTTGGACAACCTGGACCCCAACTTCCAGAGCGACCAGCAGAGCAAGCGCACGCCCCTGCATGCAGCCGCCCAGAAGGGC
::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::
GCAGAAGGTGATCCTGATGCTG---GACAACCTGGACCCCAACTTCCAGAGCGACCAGCAGAGCAAGCGCACGCCCCTGCACGCGGCCGCCCAGAAGGGC
--Q--K--V--I--L--M--L-----D--N--L--D--P--N--F--Q--S--D--Q--Q--S--K--R--T--P--L--H--A--A--A--Q--K--G-

-----------------------------------><---------------------------------------------------------------
-S--V--E--I--C--H--V--L--L--Q--A--G--A--N--I--N--A--V--D--K--Q--Q--R--T--P--L--M--E--A--V--V--N--N--
TCCGTGGAGATCTGCCATGTGCTGCTGCAGGCTGGAGCCAACATAAATGCAGTGGACAAACAGCAGCGGACGCCACTGATGGAGGCCGTGGTGAACAACC
:: ::::::::::::::.:::::::::::::::::::::::::: ::.:::::::::::.::::::::::::::.:::::::::::.:::::::::::::
TCAGTGGAGATCTGCCACGTGCTGCTGCAGGCTGGAGCCAACATCAACGCAGTGGACAAGCAGCAGCGGACGCCGCTGATGGAGGCTGTGGTGAACAACC
-S--V--E--I--C--H--V--L--L--Q--A--G--A--N--I--N--A--V--D--K--Q--Q--R--T--P--L--M--E--A--V--V--N--N--

----------------------------------------------------------><----------------------------------------
H--L--E--V--A--R--Y--M--V--Q--R--G--G--C--V--Y--S--K--E--E--D--G--S--T--C--L--H--H--A--A--K--I--G--N
ACCTGGAGGTAGCCCGTTACATGGTGCAGCGTGGTGGCTGTGTCTATAGCAAGGAGGAGGACGGTTCCACCTGCCTCCACCACGCAGCCAAAATCGGGAA
::::::::::.::.:::::::::::::::::.::.:::::.:::::.:::::::::::.:::::.:::::::::::::::::::::::::::::.:::::
ACCTGGAGGTGGCTCGTTACATGGTGCAGCGCGGCGGCTGCGTCTACAGCAAGGAGGAAGACGGCTCCACCTGCCTCCACCACGCAGCCAAAATTGGGAA
H--L--E--V--A--R--Y--M--V--Q--R--G--G--C--V--Y--S--K--E--E--D--G--S--T--C--L--H--H--A--A--K--I--G--N

------------------------------------------------------------><--------------------------------------
--L--E--M--V--S--L--L--L--S--T--G--Q--V--D--V--N--A--Q--D--S--G--G--W--T--P--I--I--W--A--A--E--H--K-
CTTGGAGATGGTCAGCCTGCTGCTGAGCACAGGACAGGTGGACGTCAACGCCCAGGACAGTGGGGGGTGGACGCCCATCATCTGGGCTGCAGAGCACAAG
..:::::::::: ::::::::::: :::::.:: ::::::::::::::::::::::::::.::::: :::::::::::::::::::::::.:::::::::
TCTGGAGATGGTGAGCCTGCTGCTCAGCACGGGTCAGGTGGACGTCAACGCCCAGGACAGCGGGGGCTGGACGCCCATCATCTGGGCTGCGGAGCACAAG
--L--E--M--V--S--L--L--L--S--T--G--Q--V--D--V--N--A--Q--D--S--G--G--W--T--P--I--I--W--A--A--E--H--K-

-----------------------------------------------------------------><---------------------------------
-H--I--E--V--I--R--M--L--L--T--R--G--A--D--V--T--L--T--D--N--E--E--N--I--C--L--H--W--A--S--F--T--G--
CACATCGAGGTGATCCGCATGCTACTGACGCGGGGCGCCGACGTCACCCTCACTGACAACGAGGAGAACATCTGCCTGCACTGGGCCTCCTTCACGGGCA
:::::::::::::::::::::::.:::::.::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::: ::::
CACATCGAGGTGATCCGCATGCTGCTGACACGGGGCGCCGACGTCACCCTCACAGACAACGAGGAGAACATCTGCCTGCACTGGGCCTCCTTCACCGGCA
-H--I--E--V--I--R--M--L--L--T--R--G--A--D--V--T--L--T--D--N--E--E--N--I--C--L--H--W--A--S--F--T--G--

----------------------------------------------------------------------------------------------------
S--A--A--I--A--E--V--L--L--N--A--R--C--D--L--H--A--V--N--Y--H--G--D--T--P--L--H--I--A--A--R--E--S--Y
GCGCCGCCATCGCCGAAGTCCTTCTGAATGCGCGCTGTGACCTCCATGCTGTCAACTACCATGGGGACACCCCCCTGCACATCGCAGCTCGGGAGAGCTA
::::::::::::::::.:::::.:::::.:: :::::::::::::::::::::::::::::.:::::::: :: ::::::::::::::.:::::::::::
GCGCCGCCATCGCCGAGGTCCTCCTGAACGCCCGCTGTGACCTCCATGCTGTCAACTACCACGGGGACACGCCGCTGCACATCGCAGCCCGGGAGAGCTA
S--A--A--I--A--E--V--L--L--N--A--R--C--D--L--H--A--V--N--Y--H--G--D--T--P--L--H--I--A--A--R--E--S--Y

--------------------><------------------------------------------------------------------------------
--H--D--C--V--L--L--F--L--S--R--G--A--N--P--E--L--R--N--K--E--G--D--T--A--W--D--L--T--P--E--R--S--D-
CCATGACTGCGTGCTGTTATTCCTGTCACGTGGGGCCAACCCTGAGCTGCGGAACAAAGAGGGGGACACAGCATGGGACCTGACTCCCGAGCGCTCCGAC
:::.:::::::::   ::.:::::::: :: ::::::::::::::::::::::::::.:::::::::::.::.:::::::::::.::.::::::::::::
CCACGACTGCGTG---TTGTTCCTGTCTCGAGGGGCCAACCCTGAGCTGCGGAACAAGGAGGGGGACACGGCGTGGGACCTGACCCCTGAGCGCTCCGAC
--H--D--C--V-----L--F--L--S--R--G--A--N--P--E--L--R--N--K--E--G--D--T--A--W--D--L--T--P--E--R--S--D-

----------------------------------------------------------------------------------------><----------
-V--W--F--A--L--Q--L--N--R--K--L--R--L--G--V--G--N--R--A--I--R--T--E--K--I--I--C--R--D--V--A--R--G--
GTGTGGTTTGCGCTTCAACTCAACCGCAAGCTCCGACTTGGGGTGGGAAATCGGGCCATCCGCACAGAGAAGATCATCTGCCGGGACGTGGCTCGGGGCT
:::::::::::.::.::.::::::::::::::.::.::.:::::::::::.::::::::.::::: :::::::::::::::   ::::::::.:::::::
GTGTGGTTTGCACTCCAGCTCAACCGCAAGCTTCGGCTCGGGGTGGGAAACCGGGCCATTCGCACTGAGAAGATCATCTGC---GACGTGGCCCGGGGCT
-V--W--F--A--L--Q--L--N--R--K--L--R--L--G--V--G--N--R--A--I--R--T--E--K--I--I--C-----D--V--A--R--G--

----------------------------------------------------------------------------------------------------
Y--E--N--V--P--I--P--C--V--N--G--V--D--G--E--P--C--P--E--D--Y--K--Y--I--S--E--N--C--E--T--S--T--M--N
ATGAGAACGTGCCCATTCCCTGTGTCAACGGTGTGGATGGGGAGCCCTGCCCTGAGGATTACAAGTACATCTCAGAGAACTGCGAGACGTCCACCATGAA
::::::::::::::::::::::::::::::: :::::..: ::::: :::::.::::::::::::::::::::.::::::::::::::::::::::::::
ATGAGAACGTGCCCATTCCCTGTGTCAACGGGGTGGACAGCGAGCCGTGCCCCGAGGATTACAAGTACATCTCGGAGAACTGCGAGACGTCCACCATGAA
Y--E--N--V--P--I--P--C--V--N--G--V--D--S--E--P--C--P--E--D--Y--K--Y--I--S--E--N--C--E--T--S--T--M--N

---------------------------------><-----------------------------------------------------------------
--I--D--R--N--I--T--H--L--Q--H--C--T--C--V--D--D--C--S--S--S--N--C--L--C--G--Q--L--S--I--R--C--W--Y-
CATCGATCGCAACATCACCCACCTGCAGCACTGCACGTGTGTGGACGACTGCTCTAGCTCCAACTGCCTGTGCGGCCAGCTCAGCATCCGGTGCTGGTAT
::::::.::::::::::: :::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::: :::::::::
CATCGACCGCAACATCACGCACCTGCAGCACTGCACGTGTGTGGACGACTGCTCCAGCTCCAACTGCCTGTGCGGCCAGCTCAGCATCCGCTGCTGGTAT
--I--D--R--N--I--T--H--L--Q--H--C--T--C--V--D--D--C--S--S--S--N--C--L--C--G--Q--L--S--I--R--C--W--Y-

-----------><---------------------------------------------------------------------------------------
-D--K--D--G--R--L--L--Q--E--F--N--K--I--E--P--P--L--I--F--E--C--N--Q--A--C--S--C--W--R--N--C--K--N--
GACAAGGATGGGCGATTGCTCCAGGAATTTAACAAGATTGAGCCTCCGCTGATTTTCGAGTGTAACCAGGCGTGCTCATGCTGGAGAAACTGCAAGAACC
::::::::::::::..:::: :::::::::::::::::.:::::.:::::::::::.:::::::::::::::::::: ::::::::::::::::::::.:
GACAAGGATGGGCGGCTGCTGCAGGAATTTAACAAGATCGAGCCCCCGCTGATTTTTGAGTGTAACCAGGCGTGCTCCTGCTGGAGAAACTGCAAGAATC
-D--K--D--G--R--L--L--Q--E--F--N--K--I--E--P--P--L--I--F--E--C--N--Q--A--C--S--C--W--R--N--C--K--N--

---------------------------><-----------------------------------------------------------------------
R--V--V--Q--S--G--I--K--V--R--L--Q--L--Y--R--T--A--K--M--G--W--G--V--R--A--L--Q--T--I--P--Q--G--T--F
GGGTCGTACAGAGTGGCATCAAGGTGCGGCTACAGCTCTACCGAACAGCCAAGATGGGCTGGGGGGTCCGCGCCCTGCAGACCATCCCACAGGGGACCTT
: :: ::.:::::.::::::   :::::.::.:::::::::::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::.::
GCGTAGTGCAGAGCGGCATC---GTGCGACTGCAGCTCTACCGAACAGCCAAGATGGGCTGGGGGGTCCGCGCCCTGCAGACCATTCCCCAGGGGACTTT
R--V--V--Q--S--G--I-----V--R--L--Q--L--Y--R--T--A--K--M--G--W--G--V--R--A--L--Q--T--I--P--Q--G--T--F

--------------><-----------------------------------------------------------------------------><-----
--I--C--E--Y--V--G--E--L--I--S--D--A--E--A--D--V--R--E--D--D--S--Y--L--F--D--L--D--N--K--D--G--E--V-
CATCTGCGAGTATGTCGGGGAGCTGATCTCTGATGCTGAGGCTGATGTGAGAGAGGATGATTCTTACCTCTTCGACTTAGACAACAAGGATGGAGAGGTG
.:: :::   ::::: ::.:::::::::::::::::.::::::::.::::::::::::::::::::.:::::::::::.:::::::::::::: ::.:: 
TATATGC---TATGTGGGAGAGCTGATCTCTGATGCCGAGGCTGACGTGAGAGAGGATGATTCTTATCTCTTCGACTTGGACAACAAGGATGGTGAAGTC
--I--C-----Y--V--G--E--L--I--S--D--A--E--A--D--V--R--E--D--D--S--Y--L--F--D--L--D--N--K--D--G--E--V-

----------------------------------------------------------------------------------------------------
-Y--C--I--D--A--R--Y--Y--G--N--I--S--R--F--I--N--H--L--C--D--P--N--I--I--P--V--R--V--F--M--L--H--Q--
TACTGCATAGATGCCCGTTACTATGGCAACATCAGCCGCTTCATCAACCACCTGTGTGACCCCAACATCATTCCCGTCCGGGTCTTCATGCTGCACCAAG
:::::::: ::::::::::::::.:::::::::::::::::::::::::::.:::::::::::::::::::.::::::::::::::::::::.:::::::
TACTGCATCGATGCCCGTTACTACGGCAACATCAGCCGCTTCATCAACCACTTGTGTGACCCCAACATCATCCCCGTCCGGGTCTTCATGCTACACCAAG
-Y--C--I--D--A--R--Y--Y--G--N--I--S--R--F--I--N--H--L--C--D--P--N--I--I--P--V--R--V--F--M--L--H--Q--

---------------------------------------------------------------------><-----------------------------
D--L--R--F--P--R--I--A--F--F--S--S--R--D--I--R--T--G--E--E--L--G--F--D--Y--G--D--R--F--W--D--I--K--S
ACCTGCGATTTCCACGCATCGCCTTCTTCAGTTCCCGAGACATCCGGACTGGGGAGGAGCTAGGGTTTGACTATGGCGACCGCTTCTGGGACATCAAAAG
:::::::::::::.:::::.:::::::::::::: ::::::::::::::.:::::::::      :::::::::::.:::::::::::::::::::::::
ACCTGCGATTTCCGCGCATTGCCTTCTTCAGTTCACGAGACATCCGGACCGGGGAGGAG------TTTGACTATGGTGACCGCTTCTGGGACATCAAAAG
D--L--R--F--P--R--I--A--F--F--S--S--R--D--I--R--T--G--E--E--------F--D--Y--G--D--R--F--W--D--I--K--S

----------------------------------------------------------------------------------------------------
--K--Y--F--T--C--Q--C--G--S--E--K--C--K--H--S--A--E--A--I--A--L--E--Q--S--R--L--A--R--L--D--P--H--P-
CAAATATTTCACCTGCCAATGTGGCTCTGAGAAGTGCAAGCACTCAGCCGAAGCCATTGCCCTGGAGCAGAGCCGTCTGGCCCGCCTGGACCCACACCCT
::::::::::::::::::.::::::::::::::::::::::::::::: ::.:::::.:::::::::::::::::.::::::::::::::::: :::::.
CAAATATTTCACCTGCCAGTGTGGCTCTGAGAAGTGCAAGCACTCAGCGGAGGCCATCGCCCTGGAGCAGAGCCGCCTGGCCCGCCTGGACCCCCACCCC
--K--Y--F--T--C--Q--C--G--S--E--K--C--K--H--S--A--E--A--I--A--L--E--Q--S--R--L--A--R--L--D--P--H--P-

---------------------------------------------
-E--L--L--P--E--L--G--S--L--P--P--V--N--T--*-
GAGCTGCTGCCCGAGCTCGGCTCCCTGCCCCCTGTCAACACATGA
::::::::::::::::::.:::::.:::::::.:::::: : :::
GAGCTGCTGCCCGAGCTCAGCTCCTTGCCCCCCGTCAACCCCTGA
-E--L--L--P--E--L--S--S--L--P--P--V--N--P--*-

Pig Consensus Sequence

>BGISUST0000896025
------------------------------------------GGGGAGGCCCCCGCTGAGATGGGGGCGCTGGTGCTGGAGAAGGAGCCCAGAGGAGCTA
CCGAGAGA---CATGGCTCTTTGGGGGACACCCCTCGTAGTGAGGAGGCCCTCCCCAAGGCCAACCCTGACTCCCTGGAACCTGCTGGCCCCTCATCCCC
AGCCTCTGTCACAGTCACCGTCGGCGATGAGGGAGCTGACACTCCTATAGGGGCCACACCTCTCATTGGGGATGAACCCGAGAATCTCGAGGGAGATGGG
GACCTCCATGGGGGACGCATCCTGCTG---CATGCCACAAAGTCATTCCCGTCTTCCCCTAGCAAGGGGGGTGCCTGTCCCAGCAGAGCCAAAATGTCAA
TGACTGGGGCTGGAAAATCACCCCCATCAGTCCAGAGTTTGGCTATGAGGCTGCTGAGTATGCCGGGGGCCCAGGGGGCAGCAGCAGCAGCAATACCTGA
ACCCCCTCCAGCCACAGCCAGCCCAGAGGGGCAGCCCAAGGTCCATCGAGCCAGGAAGACCATGTCTAAA------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--GGTTCCAGCGGCCGGCGCAAAGCCAAGAAGAAGTGGCGGAAGGACAGTCCGTGGGTGAAGCCGTCACGGAAACGGCGGAAGCGGGAGCCTCCGAGGGC
CAAAGAGCCACGA---GTGAATGGTGTGGGCTCCTCAGGCCCCAGTGAGTACATGGAGGTCCCTCTGGGGTCCCTGGAGCTGCCCAGCGAGGGGACCCTC
TCTCCCAACCACGCT------------------------------------------------------CCCCTccANTGCCGcgNAGCACCCAAGATAG
ACCGCATCAGTGAGAGAGCGGNGCACAAGTGCATGGCCACGGAGAGTGTGGATGGAGAGCTATCGGGCTGCAACGCCGCGATCCTCAAGCGGGAGACCAT
GAGACCGTCGAGCCGCGTGGCCCTGATGGTGCTCTGTGAGACCCACCGCGCCCGCATGGTCAAACACCACTGCTGCCCAGGCTGTGGCTACTTCTGTACG
GCGGGCACCTTCCTGGAGTGCCACCCCGACTTCCGAGTGGCCCACCGCTTCCACAAGGCcgGCGTGTCCCAGCTCAACGGGATGGTCTTCTGTCCCCACT
GTGGGGAGGACGCATCTGAGGCCCAAGAGGTGACCATCCCCCGGGGGGATGGGGTGACCCCACCAGCGGGCACTGCAGCCCCCGCCCCCCCACCCCTGGC
ACAGGATGCCCCCGGGAGAGCGGACACTTCCCAGCCC---GCCCGGATGCGAGGTCACGGGGAGCCCCGGCGGCCCCCCTGCGACCCCCTGGCTGACACC
ATCGACAGCTCGGGGCCCTCCCTgaCCCTgcCCAGTGGAGGCTGCCTCTCAGATGTGGGGCTGCCACCTGGGCCAGGCCGGGAGGCCCTGGAGAAGGCAC
TGGTCATCCAGGAGTCGGAG---CGGAAGAAACTCCGTTTCCACCCCCGGCAGCTGTACCTGTCAGTGAAGCAGGGCGAGCTGCAGAAGGTGATCCTGAT
GCTG---GACAACCTGGACCCCAACTTCCAGAGCGACCAGCAGAGCAAGCGCACGCCCCTGCACGCGGCCGCCCAGAAGGGCTCAGTGGAGATCTGCCAC
GTGCTGCTGCAGGCTGGAGCCAACATCAACGCAGTGGACAAGCAGCAGCGGACGCCGCTGATGGAGGCTGTGGTGAACAACCACCTGGAGGTGGCTCGTT
ACATGGTGCAGCGCGGCGGCTGCGTCTACAGCAAGGAGGAAGACGGCTCCACCTGCCTCCACCACGCAGCCAAAATTGGGAATCTGGAGATGGTGAGCCT
GCTGCTCAGCACGGGTCAGGTGGACGTCAACGCCCAGGACAGCGGGGGCTGGACGCCCATCATCTGGGCTGCGGAGCACAAGCACATCGAGGTGATCCGC
ATGCTGCTGACACGGGGCGCCGACGTCACCCTCACAGACAACGAGGAGAACATCTGCCTGCACTGGGCCTCCTTCACCGGCAGCGCCGCCATCGCCGAGG
TCCTCCTGAACGCCCGCTGTGACCTCCATGCTGTCAACTACCACGGGGACACGCCGCTGCACATCGCAGCCCGGGAGAGCTACCACGACTGCGTG---TT
GTTCCTGTCTCGAGGGGCCAACCCTGAGCTGCGGAACAAGGAGGGGGACACGGCGTGGGACCTGACCCCTGAGCGCTCCGACGTGTGGTTTGCACTCCAG
CTCAACCGCAAGCTTCGGCTCGGGGTGGGAAACCGGGCCATTCGCACTGAGAAGATCATCTGC---GACGTGGCCCGGGGCTATGAGAACGTGCCCATTC
CCTGTGTCAACGGGGTGGACAGCGAGCCGTGCCCCGAGGATTACAAGTACATCTCGGAGAACTGCGAGACGTCCACCATGAACATCGACCGCAACATCAC
GCACCTGCAGCACTGCACGTGTGTGGACGACTGCTCCAGCTCCAACTGCCTGTGCGGCCAGCTCAGCATCCGCTGCTGGTATGACAAGGATGGGCGGCTG
CTGCAGGAATTTAACAAGATCGAGCCCCCGCTGATTTTTGAGTGTAACCAGGCGTGCTCCTGCTGGAGAAACTGCAAGAATCGCGTAGTGCAGAGCGGCA
TC---GTGCGACTGCAGCTCTACCGAACAGCCAAGATGGGCTGGGGGGTCCGCGCCCTGCAGACCATTCCCCAGGGGACTTTTATATGC---TATGTGGG
AGAGCTGATCTCTGATGCCGAGGCTGACGTGAGAGAGGATGATTCTTATCTCTTCGACTTGGACAACAAGGATGGTGAAGTCTACTGCATCGATGCCCGT
TACTACGGCAACATCAGCCGCTTCATCAACCACTTGTGTGACCCCAACATCATCCCCGTCCGGGTCTTCATGCTACACCAAGACCTGCGATTTCCGCGCA
TTGCCTTCTTCAGTTCACGAGACATCCGGACCGGGGAGGAG------TTTGACTATGGTGACCGCTTCTGGGACATCAAAAGCAAATATTTCACCTGCCA
GTGTGGCTCTGAGAAGTGCAAGCACTCAGCGGAGGCCATCGCCCTGGAGCAGAGCCGCCTGGCCCGCCTGGACCCCCACCCCGAGCTGCTGCCCGAGCTC
AGCTCCTTGCCCCCCGTCAACCCCTGA


>BGISUSP0000896025
--------------GEAPAEMGALVLEKEPRGATER-HGSLGDTPRSEEALPKANPDSLEPAGPSSPASVTVTVGDEGADTPIGATPLIGDEPENLEGDG
DLHGGRILL-HATKSFPSSPSKGGACPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAAAAAIPEPPPATASPEGQPKVHRARKTMSK----------
----------------------------------------------------------------------------------------------------
----------------------------------GSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRAKEPR-VNGVGSSGPSEYMEVPLGSLELPSEGTL
SPNHA------------------PL-CR-APKIDRISERA-HKCMATESVDGELSGCNAAILKRETMRPSSRVALMVLCETHRARMVKHHCCPGCGYFCT
AGTFLECHPDFRVAHRFHKAGVSQLNGMVFCPHCGEDASEAQEVTIPRGDGVTPPAGTAAPAPPPLAQDAPGRADTSQP-ARMRGHGEPRRPPCDPLADT
IDSSGPSLTLPSGGCLSDVGLPPGPGREALEKALVIQESE-RKKLRFHPRQLYLSVKQGELQKVILML-DNLDPNFQSDQQSKRTPLHAAAQKGSVEICH
VLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIR
MLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCV-LFLSRGANPELRNKEGDTAWDLTPERSDVWFALQ
LNRKLRLGVGNRAIRTEKIIC-DVARGYENVPIPCVNGVDSEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRL
LQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGI-VRLQLYRTAKMGWGVRALQTIPQGTFIC-YVGELISDAEADVREDDSYLFDLDNKDGEVYCIDAR
YYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEE--FDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPEL
SSLPPVNP*