Sequences
EST Library Info
cad1Unavailable
cli1Liver - RNA from China
cly1Lymph - RNA from China
cov1Ovary - RNA from China
csp2Spleen - RNA from China
ebs2Foetus 50 days, brain stem
fhi3Unavailable
hea1Heart
jej1Small intestine, jejunum
nco3Newborn 115 days, colon
nje2Newborn 115 days, jejunum
nmm1Newborn 115 days, mucosal membranes
pigcb3Unavailable
sin1Small intestine
ssp6M. Supraspinatus
thg1Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000137330 (click for geneview)
Transcript ID ENST00000259873(link to ensembl)
Symbol MRPS18B
Localtion Chromosome:6:30693585:30702148:1 band: 6p21.33
Description 28S ribosomal protein S18b, mitochondrial precursor (MRP-S18-b) (Mrps18b) (MRP-S18-2). [Source:Uniprot/SWISSPROT;Acc:Q9Y676]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------------------------------><---------------------
-M--A--A--S--V--L--N--T--V--L--R--R--L--P--M--L--S--L--F--R--G--S--H--R--V--Q--V--P--L--Q--T--L--C--
ATGGCGGCGTCTGTATTAAACACCGTGCTGAGGCGGCTTCCTATGCTATCTCTCTTCCGAGGTTCTCACAGAGTTCAGGTTCCCCTCCAGACTCTTTGCA
                                                                              ::::.:::::::::::::::::
------------------------------------------------------------------------------GTTCTCCTCCAGACTCTTTGCA
-------------------------------------------------------------------------------V--L--L--Q--T--L--C--

--------------------------------------------------------------------------------------><------------
T--K--A--P--S--E--E--D--S--L--S--S--V--P--I--S--P--Y--K--D--E--P--W--K--Y--L--E--S--E--E--Y--Q--E--R
CCAAAGCTCCCTCTGAGGAAGATTCTTTGTCCTCAGTTCCCATTTCTCCTTATAAGGATGAGCCCTGGAAATATCTGGAATCAGAAGAATACCAGGAGCG
:::::::::::.::::::: :::::::::.::. .:::::::::::.::::::::.:::::.::::::::::::::::: ::::::   ::::::.: ::
CCAAAGCTCCCCCTGAGGATGATTCTTTGCCCCAGGTTCCCATTTCCCCTTATAAAGATGAACCCTGGAAATATCTGGACTCAGAA---TACCAGAACCG
T--K--A--P--P--E--D--D--S--L--P--Q--V--P--I--S--P--Y--K--D--E--P--W--K--Y--L--D--S--E-----Y--Q--N--R

------------------------------------------------------------------------------------><--------------
--Y--G--S--R--P--V--W--A--D--Y--R--R--N--H--K--G--G--V--P--P--Q--R--T--R--K--T--C--I--R--R--N--K--V-
ATATGGTTCTCGCCCCGTCTGGGCTGACTACCGCCGCAACCACAAGGGTGGTGTACCCCCACAGCGGACTCGGAAGACATGTATTCGTCGGAATAAAGTT
 ::::::::::::::.:::::::::::::::::.:::::::::::.::::: .:::::::::::::::::::.::::..::::::               
CTATGGTTCTCGCCCTGTCTGGGCTGACTACCGTCGCAACCACAAAGGTGGAATACCCCCACAGCGGACTCGAAAGATGTGTATT---------------
--Y--G--S--R--P--V--W--A--D--Y--R--R--N--H--K--G--G--I--P--P--Q--R--T--R--K--M--C--I----------------

-----------------------------------------------------><---------------------------------------------
-V--G--N--P--C--P--I--C--R--D--H--K--L--H--V--D--F--R--N--V--K--L--L--E--Q--F--V--C--A--H--T--G--I--
GTTGGGAATCCCTGCCCCATCTGTCGAGATCACAAGTTGCATGTTGACTTTAGGAACGTGAAGCTCTTGGAGCAATTTGTCTGCGCCCACACGGGTATCA
   ::::::::::::::::::::.::.::::: ::::::::.::.:::::::::::::::::::::::::::::.:::::::::::::::::::::::::
---GGGAATCCCTGCCCCATCTGCCGGGATCAGAAGTTGCACGTCGACTTTAGGAACGTGAAGCTCTTGGAGCAGTTTGTCTGCGCCCACACGGGTATCA
----G--N--P--C--P--I--C--R--D--Q--K--L--H--V--D--F--R--N--V--K--L--L--E--Q--F--V--C--A--H--T--G--I--

--------------------><----------------------------------------------------------><------------------
I--F--Y--A--P--Y--T--G--V--C--V--K--Q--H--K--R--L--T--Q--A--I--Q--K--A--R--D--H--G--L--L--I--Y--H--I
TCTTCTATGCTCCATACACAGGAGTCTGTGTGAAGCAGCACAAGCGGTTGACCCAGGCCATCCAGAAAGCCAGGGATCATGGTCTCCTCATTTACCACAT
:::::.::::.::.::::::   ::::::.:::::::.:::::: .::::::::::::::::::::::::::::::::::   ::.::::  ::::::::
TCTTCCATGCCCCGTACACA---GTCTGTATGAAGCAACACAAGAAGTTGACCCAGGCCATCCAGAAAGCCAGGGATCAT---CTTCTCAGGTACCACAT
I--F--H--A--P--Y--T-----V--C--M--K--Q--H--K--K--L--T--Q--A--I--Q--K--A--R--D--H-----L--L--R--Y--H--I

----------------------------------------------------------------------------------------------------
--P--Q--V--E--P--R--D--L--D--F--S--T--S--H--G--A--V--S--A--T--P--P--A--P--T--L--V--S--G--D--P--W--Y-
CCCCCAGGTTGAACCACGGGACCTTGACTTCAGTACCTCTCATGGGGCTGTGAGTGCTACTCCGCCAGCCCCCACCCTGGTCTCAGGTGACCCCTGGTAC
.:::::::::::::: ::::::::::::::::::::: :::::::.::::::::: :::::::::::::::::::.:::::.::::::::::::::::::
TCCCCAGGTTGAACCCCGGGACCTTGACTTCAGTACCACTCATGGAGCTGTGAGTTCTACTCCGCCAGCCCCCACTCTGGTTTCAGGTGACCCCTGGTAC
--P--Q--V--E--P--R--D--L--D--F--S--T--T--H--G--A--V--S--S--T--P--P--A--P--T--L--V--S--G--D--P--W--Y-

----------------------------------------------------------------------------------------------------
-P--W--Y--N--W--K--Q--P--P--E--R--E--L--S--R--L--R--R--L--Y--Q--G--H--L--Q--E--E--S--G--P--P--P--E--
CCATGGTACAACTGGAAACAGCCACCGGAGAGAGAACTGTCTCGCCTTCGCCGGCTTTACCAGGGTCATCTCCAAGAAGAGAGTGGCCCCCCACCTGAGT
::::::::::.:::::::::::::::.::::::::.:::::.::::::::::::::.::.:::::.:.:::.:.::::::.::::::::.::::::::::
CCATGGTACAGCTGGAAACAGCCACCAGAGAGAGAGCTGTCCCGCCTTCGCCGGCTCTATCAGGGCCGTCTTCGAGAAGAAAGTGGCCCTCCACCTGAGT
-P--W--Y--S--W--K--Q--P--P--E--R--E--L--S--R--L--R--R--L--Y--Q--G--R--L--R--E--E--S--G--P--P--P--E--

---------------------------------------------------------------------------->
S--M--P--K--M--P--P--R--T--P--A--E--A--S--S--T--G--Q--T--G--P--Q--S--A--L--*-
CAATGCCCAAGATGCCCCCTAGAACACCAGCGGAAGCCTCCTCCACTGGGCAGACAGGCCCTCAGAGTGCTCTGTAG
.:::::::.::.::::::.:: :.: ::::: ::::::::::::::::.::  . .: ::: ::.::::::::::::
TAATGCCCGAGGTGCCCCTTACAGCCCCAGCTGAAGCCTCCTCCACTGAGCCTGGGGCCCCGCAAAGTGCTCTGTAG
L--M--P--E--V--P--L--T--A--P--A--E--A--S--S--T--E--P--G--A--P--Q--S--A--L--*-

Pig Consensus Sequence

>BGISUST0000893471
------------------------------------------------------------------------------GTTCTCCTCCAGACTCTTTGCA
CCAAAGCTCCCCCTGAGGATGATTCTTTGCCCCAGGTTCCCATTTCCCCTTATAAAGATGAACCCTGGAAATATCTGGACTCAGAA---TACCAGAACCG
CTATGGTTCTCGCCCTGTCTGGGCTGACTACCGTCGCAACCACAAAGGTGGAATACCCCCACAGCGGACTCGAAAGATGTGTATT---------------
---GGGAATCCCTGCCCCATCTGCCGGGATCAGAAGTTGCACGTCGACTTTAGGAACGTGAAGCTCTTGGAGCAGTTTGTCTGCGCCCACACGGGTATCA
TCTTCCATGCCCCGTACACA---GTCTGTATGAAGCAACACAAGAAGTTGACCCAGGCCATCCAGAAAGCCAGGGATCAT---CTTCTCAGGTACCACAT
TCCCCAGGTTGAACCCCGGGACCTTGACTTCAGTACCACTCATGGAGCTGTGAGTTCTACTCCGCCAGCCCCCACTCTGGTTTCAGGTGACCCCTGGTAC
CCATGGTACAGCTGGAAACAGCCACCAGAGAGAGAGCTGTCCCGCCTTCGCCGGCTCTATCAGGGCCGTCTTCGAGAAGAAAGTGGCCCTCCACCTGAGT
TAATGCCCGAGGTGCCCCTTACAGCCCCAGCTGAAGCCTCCTCCACTGAGCCTGGGGCCCCGCAAAGTGCTCTGTAG


>BGISUSP0000893471
--------------------------VLLQTLCTKAPPEDDSLPQVPISPYKDEPWKYLDSE-YQNRYGSRPVWADYRRNHKGGIPPQRTRKMCI-----
-GNPCPICRDQKLHVDFRNVKLLEQFVCAHTGIIFHAPYT-VCMKQHKKLTQAIQKARDH-LLRYHIPQVEPRDLDFSTTHGAVSSTPPAPTLVSGDPWY
PWYSWKQPPERELSRLRRLYQGRLREESGPPPELMPEVPLTAPAEASSTEPGAPQSAL*