Sequences
EST Library Info
jca2Joint capsule
plac2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000137331 (click for geneview)
Transcript ID ENST00000259874(link to ensembl)
Symbol IER3
Localtion Chromosome:6:30818956:30820303:-1 band: 6p21.33
Description Radiation-inducible immediate-early gene IEX-1 (Immediate early protein GLY96) (Immediate early response 3 protein) (PACAP-responsive gene 1 protein) (PRG1 protein) (Differentiation-dependent gene 2 protein) (DIF-2 protein). [Source:Uniprot/SWISSPROT;Acc:P46695]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--C--H--S--R--S--C--H--P--T--M--T--I--L--Q--A--P--T--P--A--P--S--T--I--P--G--P--R--R--G--S--G--P--
ATGTGTCACTCTCGCAGCTGCCACCCGACCATGACCATCCTGCAGGCCCCGACCCCGGCCCCCTCCACCATCCCGGGACCCCGGCGGGGCTCCGGTCCTG
::::::::::::::::::: .: ::: ::::::::::::::::.:::::::::::::::::::::::::: ::::: .::::::::.:::::.:::::.:
ATGTGTCACTCTCGCAGCTCTCTCCCTACCATGACCATCCTGCGGGCCCCGACCCCGGCCCCCTCCACCAGCCCGGTGCCCCGGCGAGGCTCTGGTCCCG
-M--C--H--S--R--S--S--L--P--T--M--T--I--L--R--A--P--T--P--A--P--S--T--S--P--V--P--R--R--G--S--G--P--

----------------------------------------------------------------------------------------------------
E--I--F--T--F--D--P--L--P--E--P--A--A--A--P--A--G--R--P--S--A--S--R--G--H--R--K--R--S--R--R--V--L--Y
AGATCTTCACCTTCGACCCTCTCCCGGAGCCCGCAGCGGCCCCTGCCGGGCGCCCCAGCGCCTCTCGCGGGCACCGAAAGCGCAGCCGCAGGGTTCTCTA
:::: :::::::::::.:::::::::::::::::.:.::::::.:::: :::::::::::::::.::::::: :::::::::::::::. ::::.:::::
AGATATTCACCTTCGATCCTCTCCCGGAGCCCGCGGTGGCCCCCGCCGCGCGCCCCAGCGCCTCCCGCGGGCTCCGAAAGCGCAGCCGTCGGGTCCTCTA
E--I--F--T--F--D--P--L--P--E--P--A--V--A--P--A--A--R--P--S--A--S--R--G--L--R--K--R--S--R--R--V--L--Y

---------><-----------------------------------------------------------------------------------------
--P--R--V--V--R--R--Q--L--P--V--E--E--P--N--P--A--K--R--L--L--F--L--L--L--T--I--V--F--C--Q--I--L--M-
CCCTCGAGTGGTCCGGCGCCAGCTGCCAGTCGAGGAACCGAACCCAGCCAAAAGGCTTCTCTTTCTGCTGCTCACCATCGTCTTCTGCCAGATCCTGATG
::: :::::::::::::::::::::::::::::::: :::::::: :::::::.::: :::::::: :::::.::::::::::::::.::::::::::::
CCCACGAGTGGTCCGGCGCCAGCTGCCAGTCGAGGATCCGAACCCTGCCAAAAAGCTACTCTTTCTCCTGCTTACCATCGTCTTCTGTCAGATCCTGATG
--P--R--V--V--R--R--Q--L--P--V--E--D--P--N--P--A--K--K--L--L--F--L--L--L--T--I--V--F--C--Q--I--L--M-

----------------------------------------------------------------------------------------------------
-A--E--E--G--V--P--A--P--L--P--P--E--D--A--P--N--A--A--S--L--A--P--T--P--V--S--A--V--L--E--P--F--N--
GCTGAAGAGGGTGTGCCGGCGCCCCTGCCTCCAGAGGACGCCCCTAACGCCGCATCCCTGGCGCCCACCCCTGTGTCCGCCGTCCTCGAGCCCTTTAATC
:::::::::::::::.::::.:::::: :.:: ::.:::.::::.:.:::: ::::::. ::::::::: :::.:.:: : ::.::.::::::.::::::
GCTGAAGAGGGTGTGTCGGCACCCCTGGCCCCTGAAGACACCCCCAGCGCCCCATCCCCCGCGCCCACCGCTGCGCCCCCAGTTCTTGAGCCCCTTAATC
-A--E--E--G--V--S--A--P--L--A--P--E--D--T--P--S--A--P--S--P--A--P--T--A--A--P--P--V--L--E--P--L--N--

---------------------------------------------------------------------->
L--T--S--E--P--S--D--Y--A--L--D--L--S--T--F--L--Q--Q--H--P--A--A--F--*-
TGACTTCGGAGCCCTCGGACTACGCTCTGGACCTCAGCACTTTCCTCCAGCAACACCCGGCCGCCTTCTAA
::::.:::::::::::::::::::::.::::::::::::::::.::::::::::::::.:::::.::::::
TGACCTCGGAGCCCTCGGACTACGCTTTGGACCTCAGCACTTTTCTCCAGCAACACCCAGCCGCTTTCTAA
L--T--S--E--P--S--D--Y--A--L--D--L--S--T--F--L--Q--Q--H--P--A--A--F--*-

Pig Consensus Sequence

>BGISUST0000889460
ATGTGTCACTCTCGCAGCTCTCTCCCTACCATGACCATCCTGCGGGCCCCGACCCCGGCCCCCTCCACCAGCCCGGTGCCCCGGCGAGGCTCTGGTCCCG
AGATATTCACCTTCGATCCTCTCCCGGAGCCCGCGGTGGCCCCCGCCGCGCGCCCCAGCGCCTCCCGCGGGCTCCGAAAGCGCAGCCGTCGGGTCCTCTA
CCCACGAGTGGTCCGGCGCCAGCTGCCAGTCGAGGATCCGAACCCTGCCAAAAAGCTACTCTTTCTCCTGCTTACCATCGTCTTCTGTCAGATCCTGATG
GCTGAAGAGGGTGTGTCGGCACCCCTGGCCCCTGAAGACACCCCCAGCGCCCCATCCCCCGCGCCCACCGCTGCGCCCCCAGTTCTTGAGCCCCTTAATC
TGACCTCGGAGCCCTCGGACTACGCTTTGGACCTCAGCACTTTTCTCCAGCAACACCCAGCCGCTTTCTAA


>BGISUSP0000889460
MCHSRSSLPTMTILRAPTPAPSTSPVPRRGSGPEIFTFDPLPEPAVAPAARPSASRGLRKRSRRVLYPRVVRRQLPVEDPNPAKKLLFLLLTIVFCQILM
AEEGVSAPLAPEDTPSAPSPAPTAAPPVLEPLNLTSEPSDYALDLSTFLQQHPAAF*