Sequences
EST Library Info
eep6Foetus 50 days, epidermis
lyg3Lymphatic gland
ski1Skin
spl2Spleen
tra1Trachea
uio2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000138035 (click for geneview)
Transcript ID ENST00000260604(link to ensembl)
Symbol PNPT1
Localtion Chromosome:2:55774118:55832610:-1 band: 2p16.1
Description polyribonucleotide nucleotidyltransferase 1
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--C--R--Y--C--C--S--C--L--R--L--R--P--L--S--D--G--P--F--L--L--P--R--R--D--R--A--L--T--Q--L--
ATGGCGGCCTGCAGGTACTGCTGCTCGTGCCTCCGGCTCCGGCCCCTGAGCGATGGTCCTTTCCTTCTGCCACGGCGGGATCGGGCACTCACCCAGTTGC
::::::::::::::: .:::::::::.:::::::::::.::::: :::.::.. :::::.:::: ::::::: :: ::::::::.:::::::::::.:::
ATGGCGGCCTGCAGGGGCTGCTGCTCATGCCTCCGGCTTCGGCCGCTGGGCAGAGGTCCCTTCCGTCTGCCAGGGAGGGATCGGACACTCACCCAGCTGC
-M--A--A--C--R--G--C--C--S--C--L--R--L--R--P--L--G--R--G--P--F--R--L--P--G--R--D--R--T--L--T--Q--L--

------------------------------------------------------------><--------------------------------------
Q--V--R--A--L--W--S--S--A--G--S--R--A--V--A--V--D--L--G--N--R--K--L--E--I--S--S--G--K--L--A--R--F--A
AAGTGCGAGCACTATGGAGTAGCGCAGGGTCTCGAGCTGTGGCCGTGGACTTAGGCAACAGGAAATTAGAAATATCTTCTGGAAAGCTGGCCAGATTTGC
:.::::::::::::::::::.::: ..::::.:::.:.:::::::::::::::::::.:   :::::::::::::: ::::::::.::::::::::::::
AGGTGCGAGCACTATGGAGTGGCGGGAGGTCCCGAACCGTGGCCGTGGACTTAGGCAGC---AAATTAGAAATATCATCTGGAAAACTGGCCAGATTTGC
Q--V--R--A--L--W--S--G--G--R--S--R--T--V--A--V--D--L--G--S-----K--L--E--I--S--S--G--K--L--A--R--F--A

---------------------><-------------------------------------------------------------------------><--
--D--G--S--A--V--V--Q--S--G--D--T--A--V--M--V--T--A--V--S--K--T--K--P--S--P--S--Q--F--M--P--L--V--V-
AGATGGCTCTGCTGTAGTACAGTCAGGTGACACTGCAGTAATGGTCACAGCGGTCAGTAAAACAAAACCTTCCCCTTCCCAGTTTATGCCTTTGGTGGTT
:::::::::::::::::::::::::::::::::::::::.:::::.:::::.:::::::::::::::::::: :::::::::::.:::::::::::::::
AGATGGCTCTGCTGTAGTACAGTCAGGTGACACTGCAGTGATGGTTACAGCAGTCAGTAAAACAAAACCTTCACCTTCCCAGTTCATGCCTTTGGTGGTT
--D--G--S--A--V--V--Q--S--G--D--T--A--V--M--V--T--A--V--S--K--T--K--P--S--P--S--Q--F--M--P--L--V--V-

----------------------------------------------------------------------------------------------------
-D--Y--R--Q--K--A--A--A--A--G--R--I--P--T--N--Y--L--R--R--E--I--G--T--S--D--K--E--I--L--T--S--R--I--
GACTACAGACAAAAAGCTGCTGCAGCAGGTAGAATTCCCACAAACTATCTGAGAAGAGAGATTGGTACTTCTGATAAAGAAATTCTAACAAGTCGAATAA
:::::.::::::::.::::::::::::::::::::::::::::::::::: ::::::::::::::: ::::::::::::::::::: :::::::::.:::
GACTATAGACAAAAGGCTGCTGCAGCAGGTAGAATTCCCACAAACTATCTTAGAAGAGAGATTGGTTCTTCTGATAAAGAAATTCTTACAAGTCGAGTAA
-D--Y--R--Q--K--A--A--A--A--G--R--I--P--T--N--Y--L--R--R--E--I--G--S--S--D--K--E--I--L--T--S--R--V--

--><------------------------------------------------><----------------------------------------------
I--D--R--S--I--R--P--L--F--P--A--G--Y--F--Y--D--T--Q--V--L--C--N--L--L--A--V--D--G--V--N--E--P--D--V
TAGATCGTTCAATTAGACCGCTCTTTCCAGCTGGCTACTTCTATGATACACAGGTTCTGTGTAATCTGTTAGCAGTAGATGGTGTAAATGAGCCTGATGT
::   :::::::::::::: ::::::::::::::::::::.::::::::::::   :: :::::::::::::::::::::::::: :::::.::::::::
TA---CGTTCAATTAGACCTCTCTTTCCAGCTGGCTACTTTTATGATACACAG---CTTTGTAATCTGTTAGCAGTAGATGGTGTTAATGAACCTGATGT
I-----R--S--I--R--P--L--F--P--A--G--Y--F--Y--D--T--Q-----L--C--N--L--L--A--V--D--G--V--N--E--P--D--V

----------------><----------------------------------------------><----------------------------------
--L--A--I--N--G--A--S--V--A--L--S--L--S--D--I--P--W--N--G--P--V--G--A--V--R--I--G--I--I--D--G--E--Y-
CCTAGCAATTAATGGCGCTTCCGTAGCCCTCTCATTATCAGATATTCCTTGGAATGGACCTGTTGGGGCAGTACGAATAGGAATAATTGATGGAGAATAT
:::::::::::::      ::.::::::::::::::::::::::: :::::::::::::::.::   :::::::::::::::::.:::::::::::::.:
CCTAGCAATTAAT------TCTGTAGCCCTCTCATTATCAGATATACCTTGGAATGGACCTATT---GCAGTACGAATAGGAATGATTGATGGAGAATGT
--L--A--I--N--------S--V--A--L--S--L--S--D--I--P--W--N--G--P--I-----A--V--R--I--G--M--I--D--G--E--C-

------------------------------------------------------------------------------><--------------------
-V--V--N--P--T--R--K--E--M--S--S--S--T--L--N--L--V--V--A--G--A--P--K--S--Q--I--V--M--L--E--A--S--A--
GTTGTTAACCCAACAAGAAAAGAAATGTCTTCTAGTACTTTAAATTTAGTGGTTGCTGGAGCACCTAAAAGTCAGATTGTCATGTTGGAAGCCTCTGCAG
::::::::::::::: ::::::::::::::::.::::::::::::                                    :::::::::::::::::::
GTTGTTAACCCAACACGAAAAGAAATGTCTTCCAGTACTTTAAAT------------------------------------ATGTTGGAAGCCTCTGCAG
-V--V--N--P--T--R--K--E--M--S--S--S--T--L--N--------------------------------------M--L--E--A--S--A--

----------------------------------------------------------------------------------------------------
E--N--I--L--Q--Q--D--F--C--H--A--I--K--V--G--V--K--Y--T--Q--Q--I--I--Q--G--I--Q--Q--L--V--K--E--T--G
AGAACATTTTACAGCAGGACTTTTGCCATGCTATCAAAGTGGGAGTGAAATATACCCAACAAATAATTCAGGGCATTCAGCAGTTGGTAAAAGAAACTGG
::::.::::::::.::::::::.:::::::::::::::::::::::::::::::: ::::::::::::::::::::.:::::::::::::::::::.:::
AGAATATTTTACAACAGGACTTCTGCCATGCTATCAAAGTGGGAGTGAAATATACACAACAAATAATTCAGGGCATCCAGCAGTTGGTAAAAGAAATTGG
E--N--I--L--Q--Q--D--F--C--H--A--I--K--V--G--V--K--Y--T--Q--Q--I--I--Q--G--I--Q--Q--L--V--K--E--I--G

-----------------------------------------------------------------><---------------------------------
--V--T--K--R--T--P--Q--K--L--F--T--P--S--P--E--I--V--K--Y--T--H--K--L--A--M--E--R--L--Y--A--V--F--T-
TGTTACCAAGAGGACACCTCAGAAGTTATTTACCCCTTCGCCAGAGATTGTGAAATATACTCATAAACTTGCTATGGAGAGACTCTATGCAGTTTTTACA
::::: :::::::::::::::::::::::::...:::::.:::::::::::::::.::.:::::                                    
TGTTAGCAAGAGGACACCTCAGAAGTTATTTGTTCCTTCACCAGAGATTGTGAAACATGCTCAT------------------------------------
--V--S--K--R--T--P--Q--K--L--F--V--P--S--P--E--I--V--K--H--A--H-------------------------------------

-----------------><--------------------------------------------------------><-----------------------
-D--Y--E--H--D--K--V--S--R--D--E--A--V--N--K--I--R--L--D--T--E--E--Q--L--K--E--K--F--P--E--A--D--P--
GATTACGAGCATGACAAAGTTTCCAGAGATGAAGCTGTTAACAAAATAAGATTAGATACGGAGGAACAACTAAAAGAAAAATTTCCAGAAGCCGATCCAT
                     :::::.:::::::::::::::::.:: :::::::::::.:::::::::::::::   :::: ::::::.:..:::.:::
---------------------TCCAGGGATGAAGCTGTTAACAAGATTAGATTAGATACAGAGGAACAACTAAAA---AAATATCCAGAGGTTGATTCAT
----------------------S--R--D--E--A--V--N--K--I--R--L--D--T--E--E--Q--L--K-----K--Y--P--E--V--D--S--

------------------------------------------------------------------------><--------------------------
Y--E--I--I--E--S--F--N--V--V--A--K--E--V--F--R--S--I--V--L--N--E--Y--K--R--C--D--G--R--D--L--T--S--L
ATGAAATAATAGAATCCTTCAATGTTGTTGCAAAGGAAGTTTTTAGAAGTATTGTTTTGAATGAATACAAAAGGTGCGATGGTCGGGATTTGACTTCACT
:::::::::::::::::::::::::::.:::::::::.:::::::::::::::.:::::::::::::::::   ::.:::::::: ::::::::::::::
ATGAAATAATAGAATCCTTCAATGTTGCTGCAAAGGAGGTTTTTAGAAGTATTATTTTGAATGAATACAAA---TGTGATGGTCGTGATTTGACTTCACT
Y--E--I--I--E--S--F--N--V--A--A--K--E--V--F--R--S--I--I--L--N--E--Y--K-----C--D--G--R--D--L--T--S--L

---------------------------------------------------------------------------><-----------------------
--R--N--V--S--C--E--V--D--M--F--K--T--L--H--G--S--A--L--F--Q--R--G--Q--T--Q--V--L--C--T--V--T--F--D-
TAGGAATGTAAGTTGTGAGGTAGATATGTTTAAAACCCTTCATGGATCAGCATTATTTCAAAGAGGACAAACACAGGTGCTTTGTACCGTTACATTTGAT
:::::::.:::. ::::::::::::::::::::::..:::::::::::: :::::::::::::::::::::::::::::::::::::.::::::::::::
TAGGAATATAAAATGTGAGGTAGATATGTTTAAAATTCTTCATGGATCATCATTATTTCAAAGAGGACAAACACAGGTGCTTTGTACTGTTACATTTGAT
--R--N--I--K--C--E--V--D--M--F--K--I--L--H--G--S--S--L--F--Q--R--G--Q--T--Q--V--L--C--T--V--T--F--D-

----------------------------------------------><-----------------------------------><---------------
-S--L--E--S--G--I--K--S--D--Q--V--I--T--A--I--N--G--I--K--D--K--N--F--M--L--H--Y--E--F--P--P--Y--A--
TCATTAGAATCTGGTATTAAGTCAGATCAAGTTATAACAGCTATAAATGGGATAAAAGATAAAAATTTCATGCTGCACTACGAGTTTCCTCCTTATGCAA
:::::::::::..:::::::::::::.:...::::::::::::::                                       ::::::::::::::::
TCATTAGAATCCAGTATTAAGTCAGACCGGATTATAACAGCTATA---------------------------------------TTTCCTCCTTATGCAA
-S--L--E--S--S--I--K--S--D--R--I--I--T--A--I-----------------------------------------F--P--P--Y--A--

--------------------------------------------------><------------------------------------------------
T--N--E--I--G--K--V--T--G--L--N--R--R--E--L--G--H--G--A--L--A--E--K--A--L--Y--P--V--I--P--R--D--F--P
CTAATGAAATTGGCAAAGTCACTGGTTTAAATAGAAGAGAACTTGGGCATGGTGCTCTTGCTGAGAAAGCTTTGTATCCTGTTATTCCCCGAGATTTTCC
::::::::::.::::::::::: ::: ::::::::::::::::::::      ::::::::::::::::::::::::::::::::.::. .:::::::::
CTAATGAAATCGGCAAAGTCACAGGTGTAAATAGAAGAGAACTTGGG------GCTCTTGCTGAGAAAGCTTTGTATCCTGTTATCCCTAAAGATTTTCC
T--N--E--I--G--K--V--T--G--V--N--R--R--E--L--G--------A--L--A--E--K--A--L--Y--P--V--I--P--K--D--F--P

----------------------------------------><----------------------------------------------------><----
--F--T--I--R--V--T--S--E--V--L--E--S--N--G--S--S--S--M--A--S--A--C--G--G--S--L--A--L--M--D--S--G--V-
TTTCACCATAAGAGTTACATCTGAAGTCCTAGAGTCAAATGGGTCATCTTCTATGGCATCTGCATGTGGCGGAAGTTTAGCATTAATGGATTCAGGGGTT
:::::::::::::::.::::::::::: ::::::::::::   ::::::::::::::::::::::::::.::::::::::::::::::::: ::   :::
TTTCACCATAAGAGTCACATCTGAAGTACTAGAGTCAAAT---TCATCTTCTATGGCATCTGCATGTGGTGGAAGTTTAGCATTAATGGATGCA---GTT
--F--T--I--R--V--T--S--E--V--L--E--S--N-----S--S--S--M--A--S--A--C--G--G--S--L--A--L--M--D--A-----V-

----------------------------------------------------------------------------------------------------
-P--I--S--S--A--V--A--G--V--A--I--G--L--V--T--K--T--D--P--E--K--G--E--I--E--D--Y--R--L--L--T--D--I--
CCAATTTCATCTGCTGTTGCAGGCGTAGCAATAGGATTGGTCACCAAAACCGATCCTGAGAAGGGTGAAATAGAAGATTATCGTTTGCTGACAGATATTT
:::::::::::::::::::::::.::.:::::::::::::::::::::: :.::::::: :::::::::::::::::::::::::::.:::::::::::.
CCAATTTCATCTGCTGTTGCAGGTGTGGCAATAGGATTGGTCACCAAAAACAATCCTGACAAGGGTGAAATAGAAGATTATCGTTTGTTGACAGATATTC
-P--I--S--S--A--V--A--G--V--A--I--G--L--V--T--K--N--N--P--D--K--G--E--I--E--D--Y--R--L--L--T--D--I--

-><----------------------------------------------------------------------><-------------------------
L--G--I--E--D--Y--N--G--D--M--D--F--K--I--A--G--T--N--K--G--I--T--A--L--Q--A--D--I--K--L--P--G--I--P
TGGGAATTGAAGATTACAATGGTGACATGGACTTCAAAATAGCTGGCACTAATAAAGGAATAACTGCATTACAGGCTGATATTAAATTACCTGGAATACC
::::.:::::::::::: :::::::::::::.:::::::::::.::::::. :::.::::::::::::::::::::::::::::::.:::::::::::::
TGGGGATTGAAGATTACCATGGTGACATGGATTTCAAAATAGCCGGCACTGCTAAGGGAATAACTGCATTACAGGCTGATATTAAACTACCTGGAATACC
L--G--I--E--D--Y--H--G--D--M--D--F--K--I--A--G--T--A--K--G--I--T--A--L--Q--A--D--I--K--L--P--G--I--P

-------------------------------------><-------------------------------------------------------------
--I--K--I--V--M--E--A--I--Q--Q--A--S--V--A--K--K--E--I--L--Q--I--M--N--K--T--I--S--K--P--R--A--S--R-
AATAAAAATTGTGATGGAGGCTATTCAACAAGCTTCAGTGGCAAAAAAGGAGATATTACAGATCATGAACAAAACTATTTCAAAACCTCGAGCATCTAGA
::::::::::::.::::::::.:::::.:::::.:::   :::::.:::::::::::::::::.::::::::::: :::.::::::::::::::::::::
AATAAAAATTGTAATGGAGGCCATTCAGCAAGCCTCA---GCAAAGAAGGAGATATTACAGATTATGAACAAAACAATTCCAAAACCTCGAGCATCTAGA
--I--K--I--V--M--E--A--I--Q--Q--A--S-----A--K--K--E--I--L--Q--I--M--N--K--T--I--P--K--P--R--A--S--R-

---------------------><-----------------------------------------------------------------------------
-K--E--N--G--P--V--V--E--T--V--Q--V--P--L--S--K--R--A--K--F--V--G--P--G--G--Y--N--L--K--K--L--Q--A--
AAAGAAAATGGACCTGTTGTAGAAACTGTTCAGGTTCCATTATCAAAACGAGCAAAATTTGTTGGACCTGGTGGCTATAACTTAAAAAAACTTCAGGCTG
:::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::: ::::::::: :.:::::::::::::::::::
AAAGAAAATGGACCTGTTGTA---ACTGTTCAGGTTCCATTATCAAAACGAGCAAAATTTGTTGGACCAGGTGGCTATCATTTAAAAAAACTTCAGGCTG
-K--E--N--G--P--V--V-----T--V--Q--V--P--L--S--K--R--A--K--F--V--G--P--G--G--Y--H--L--K--K--L--Q--A--

-----><---------------------------------------------------------------------------------------------
E--T--G--V--T--I--S--Q--V--D--E--E--T--F--S--V--F--A--P--T--P--S--A--M--H--E--A--R--D--F--I--T--E--I
AAACAGGTGTAACTATTAGTCAGGTGGATGAAGAAACGTTTTCTGTATTTGCACCAACACCCAGTGCTATGCATGAGGCAAGAGACTTCATTACTGAAAT
:::::                     :::::::::::.:::::..:::::::::::::::::::::::::::::::.::::.::::::::::::::::::
AAACA---------------------GATGAAGAAACATTTTCCATATTTGCACCAACACCCAGTGCTATGCATGAAGCAAAAGACTTCATTACTGAAAT
E--T-----------------------D--E--E--T--F--S--I--F--A--P--T--P--S--A--M--H--E--A--K--D--F--I--T--E--I

------------><------------------------------------------------------><------------------------------
--C--K--D--D--Q--E--Q--Q--L--E--F--G--A--V--Y--T--A--T--I--T--E--I--R--D--T--G--V--M--V--K--L--Y--P-
CTGCAAGGATGATCAGGAGCAGCAATTAGAATTTGGAGCAGTATATACCGCCACAATAACTGAAATCAGAGATACTGGTGTAATGGTAAAATTATATCCA
::::::.:::::::::::::::::::::::::::::::::::.::.:::::.:::::::::::::::   ::.::::: :::::::: :::.: ::::::
CTGCAAAGATGATCAGGAGCAGCAATTAGAATTTGGAGCAGTGTACACCGCTACAATAACTGAAATC---GACACTGGAGTAATGGTTAAACTTTATCCA
--C--K--D--D--Q--E--Q--Q--L--E--F--G--A--V--Y--T--A--T--I--T--E--I-----D--T--G--V--M--V--K--L--Y--P-

-----------------------------------------------><----------------------------------------------><---
-N--M--T--A--V--L--L--H--N--T--Q--L--D--Q--R--K--I--K--H--P--T--A--L--G--L--E--V--G--Q--E--I--Q--V--
AATATGACTGCGGTACTGCTTCATAACACACAACTTGATCAACGAAAGATTAAACATCCTACTGCCCTAGGATTAGAAGTTGGCCAAGAAATTCAGGTGA
:::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::. ::::..:::::::::::::::::::::::::::::::::
AATATGACTGCAGTACTACTTCATAACACACAACTTGATCAACGAAAGATTAAACATCCCCCTGCTTTAGGATTAGAAGTTGGCCAAGAAATTCAGGTGA
-N--M--T--A--V--L--L--H--N--T--Q--L--D--Q--R--K--I--K--H--P--P--A--L--G--L--E--V--G--Q--E--I--Q--V--

----------------------------------------------------------------------------------------------------
K--Y--F--G--R--D--P--A--D--G--R--M--R--L--S--R--K--V--L--Q--S--P--A--T--T--V--V--R--T--L--N--D--R--S
AATACTTTGGACGTGACCCAGCCGATGGAAGAATGAGGCTTTCTCGAAAAGTGCTTCAGTCGCCAGCTACAACCGTGGTCAGAACTTTGAATGACAGAAG
::::.:::::::::::.:::::.::::::::.::: :::::::::: ::::::::.::::: :::::::::::..: ::::.::::::.::::::::::.
AATATTTTGGACGTGATCCAGCTGATGGAAGGATGCGGCTTTCTCGTAAAGTGCTCCAGTCTCCAGCTACAACTATTGTCAAAACTTTAAATGACAGAAA
K--Y--F--G--R--D--P--A--D--G--R--M--R--L--S--R--K--V--L--Q--S--P--A--T--T--I--V--K--T--L--N--D--R--N

--------------------------------------------------->
--S--I--V--M--G--E--P--I--S--Q--S--S--S--N--S--Q--*-
TAGTATTGTAATGGGAGAACCTATTTCACAGTCATCATCTAATTCTCAGTGA
.::::::::::::::::::.::::::::::::::::::::::::::      
CAGTATTGTAATGGGAGAATCTATTTCACAGTCATCATCTAATTCT------
--S--I--V--M--G--E--S--I--S--Q--S--S--S--N--S-------

Pig Consensus Sequence

>BGISUST0000896709
ATGGCGGCCTGCAGGGGCTGCTGCTCATGCCTCCGGCTTCGGCCGCTGGGCAGAGGTCCCTTCCGTCTGCCAGGGAGGGATCGGACACTCACCCAGCTGC
AGGTGCGAGCACTATGGAGTGGCGGGAGGTCCCGAACCGTGGCCGTGGACTTAGGCAGC---AAATTAGAAATATCATCTGGAAAACTGGCCAGATTTGC
AGATGGCTCTGCTGTAGTACAGTCAGGTGACACTGCAGTGATGGTTACAGCAGTCAGTAAAACAAAACCTTCACCTTCCCAGTTCATGCCTTTGGTGGTT
GACTATAGACAAAAGGCTGCTGCAGCAGGTAGAATTCCCACAAACTATCTTAGAAGAGAGATTGGTTCTTCTGATAAAGAAATTCTTACAAGTCGAGTAA
TA---CGTTCAATTAGACCTCTCTTTCCAGCTGGCTACTTTTATGATACACAG---CTTTGTAATCTGTTAGCAGTAGATGGTGTTAATGAACCTGATGT
CCTAGCAATTAAT------TCTGTAGCCCTCTCATTATCAGATATACCTTGGAATGGACCTATT---GCAGTACGAATAGGAATGATTGATGGAGAATGT
GTTGTTAACCCAACACGAAAAGAAATGTCTTCCAGTACTTTAAAT------------------------------------ATGTTGGAAGCCTCTGCAG
AGAATATTTTACAACAGGACTTCTGCCATGCTATCAAAGTGGGAGTGAAATATACACAACAAATAATTCAGGGCATCCAGCAGTTGGTAAAAGAAATTGG
TGTTAGCAAGAGGACACCTCAGAAGTTATTTGTTCCTTCACCAGAGATTGTGAAACATGCTCAT------------------------------------
---------------------TCCAGGGATGAAGCTGTTAACAAGATTAGATTAGATACAGAGGAACAACTAAAA---AAATATCCAGAGGTTGATTCAT
ATGAAATAATAGAATCCTTCAATGTTGCTGCAAAGGAGGTTTTTAGAAGTATTATTTTGAATGAATACAAA---TGTGATGGTCGTGATTTGACTTCACT
TAGGAATATAAAATGTGAGGTAGATATGTTTAAAATTCTTCATGGATCATCATTATTTCAAAGAGGACAAACACAGGTGCTTTGTACTGTTACATTTGAT
TCATTAGAATCCAGTATTAAGTCAGACCGGATTATAACAGCTATA---------------------------------------TTTCCTCCTTATGCAA
CTAATGAAATCGGCAAAGTCACAGGTGTAAATAGAAGAGAACTTGGG------GCTCTTGCTGAGAAAGCTTTGTATCCTGTTATCCCTAAAGATTTTCC
TTTCACCATAAGAGTCACATCTGAAGTACTAGAGTCAAAT---TCATCTTCTATGGCATCTGCATGTGGTGGAAGTTTAGCATTAATGGATGCA---GTT
CCAATTTCATCTGCTGTTGCAGGTGTGGCAATAGGATTGGTCACCAAAAACAATCCTGACAAGGGTGAAATAGAAGATTATCGTTTGTTGACAGATATTC
TGGGGATTGAAGATTACCATGGTGACATGGATTTCAAAATAGCCGGCACTGCTAAGGGAATAACTGCATTACAGGCTGATATTAAACTACCTGGAATACC
AATAAAAATTGTAATGGAGGCCATTCAGCAAGCCTCA---GCAAAGAAGGAGATATTACAGATTATGAACAAAACAATTCCAAAACCTCGAGCATCTAGA
AAAGAAAATGGACCTGTTGTA---ACTGTTCAGGTTCCATTATCAAAACGAGCAAAATTTGTTGGACCAGGTGGCTATCATTTAAAAAAACTTCAGGCTG
AAACA---------------------GATGAAGAAACATTTTCCATATTTGCACCAACACCCAGTGCTATGCATGAAGCAAAAGACTTCATTACTGAAAT
CTGCAAAGATGATCAGGAGCAGCAATTAGAATTTGGAGCAGTGTACACCGCTACAATAACTGAAATC---GACACTGGAGTAATGGTTAAACTTTATCCA
AATATGACTGCAGTACTACTTCATAACACACAACTTGATCAACGAAAGATTAAACATCCCCCTGCTTTAGGATTAGAAGTTGGCCAAGAAATTCAGGTGA
AATATTTTGGACGTGATCCAGCTGATGGAAGGATGCGGCTTTCTCGTAAAGTGCTCCAGTCTCCAGCTACAACTATTGTCAAAACTTTAAATGACAGAAA
CAGTATTGTAATGGGAGAATCTATTTCACAGTCATCATCTAATTCT------


>BGISUSP0000896709
MAACRGCCSCLRLRPLGRGPFRLPGRDRTLTQLQVRALWSGGRSRTVAVDLGS-KLEISSGKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVV
DYRQKAAAAGRIPTNYLRREIGSSDKEILTSRVI-RSIRPLFPAGYFYDTQ-LCNLLAVDGVNEPDVLAIN--SVALSLSDIPWNGPI-AVRIGMIDGEC
VVNPTRKEMSSSTLN------------MLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKEIGVSKRTPQKLFVPSPEIVKHAH------------
-------SRDEAVNKIRLDTEEQLK-KYPEVDSYEIIESFNVAAKEVFRSIILNEYK-CDGRDLTSLRNIKCEVDMFKILHGSSLFQRGQTQVLCTVTFD
SLESSIKSDRIITAI-------------FPPYATNEIGKVTGVNRRELG--ALAEKALYPVIPKDFPFTIRVTSEVLESN-SSSMASACGGSLALMDA-V
PISSAVAGVAIGLVTKNNPDKGEIEDYRLLTDILGIEDYHGDMDFKIAGTAKGITALQADIKLPGIPIKIVMEAIQQAS-AKKEILQIMNKTIPKPRASR
KENGPVV-TVQVPLSKRAKFVGPGGYHLKKLQAET-------DEETFSIFAPTPSAMHEAKDFITEICKDDQEQQLEFGAVYTATITEI-DTGVMVKLYP
NMTAVLLHNTQLDQRKIKHPPALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTIVKTLNDRNSIVMGESISQSSSNS--