Sequences
EST Library Info
dbla5Unavailable
fat1Fatt
hlv2Heart, left ventricle
pfco2Unavailable
pldo1Unavailable
pliv1Unavailable
plun2Unavailable
pro1Prostata
sag2Salivary gland
spc2Spinal cord
ssp3M. Supraspinatus
Clusters
Oligos
SNPs

Gene ID ENSG00000121897 (click for geneview)
Transcript ID ENST00000261434(link to ensembl)
Symbol LIAS
Localtion Chromosome:4:39283231:39301835:1 band: 4p14
Description Lipoic acid synthetase, mitochondrial precursor (Lip-syn) (Lipoate synthase) (HUSSY-01). [Source:Uniprot/SWISSPROT;Acc:O43766]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------><------------------------------------------------------
-M--S--L--R--C--G--D--A--A--R--T--L--G--P--R--V--F--G--R--Y--F--C--S--P--V--R--P--L--S--S--L--P--D--
ATGTCTCTACGCTGCGGGGATGCAGCCCGCACCCTGGGGCCCCGGGTATTTGGGAGATATTTTTGCAGCCCAGTCAGACCGTTAAGCTCCTTGCCAGATA
                                                               :::::.::::::::: :. ::::.:::::::::::::
---------------------------------------------------------------TGCAGTCCAGTCAGAGCAATAAGTTCCTTGCCAGATA
----------------------------------------------------------------C--S--P--V--R--A--I--S--S--L--P--D--

----------------------------------------------------------------------------------------------------
K--K--K--E--L--L--Q--N--G--P--D--L--Q--D--F--V--S--G--D--L--A--D--R--S--T--W--D--E--Y--K--G--N--L--K
AAAAAAAGGAACTCCTACAGAATGGACCAGACCTTCAAGATTTTGTATCTGGTGATCTTGCAGACAGGAGCACCTGGGATGAATATAAAGGAAACCTAAA
:::::::::::.:..::::::::::::::::::::::::::::: :::::::::::::::::::::.::::::::::::::: :::::::::::::::::
AAAAAAAGGAATTTTTACAGAATGGACCAGACCTTCAAGATTTTCTATCTGGTGATCTTGCAGACAAGAGCACCTGGGATGACTATAAAGGAAACCTAAA
K--K--K--E--F--L--Q--N--G--P--D--L--Q--D--F--L--S--G--D--L--A--D--K--S--T--W--D--D--Y--K--G--N--L--K

-----------------><---------------------------------------------------------------------------------
--R--Q--K--G--E--R--L--R--L--P--P--W--L--K--T--E--I--P--M--G--K--N--Y--N--K--L--K--N--T--L--R--N--L-
ACGCCAGAAAGGAGAAAGGTTAAGACTACCTCCATGGCTAAAGACAGAGATTCCCATGGGGAAAAATTACAATAAACTGAAAAATACTTTGCGGAATTTA
::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::.::::: ::::::::::::
ACGCCAGAAAGGAGAA---TTAAGACTACCTCCATGGCTAAAGACAGAGATTCCCATGGGGAAAAATTACAATAGACTGAAGAATACATTGCGGAATTTA
--R--Q--K--G--E-----L--R--L--P--P--W--L--K--T--E--I--P--M--G--K--N--Y--N--R--L--K--N--T--L--R--N--L-

-----------><-------------------------------------------------------------------------------><------
-N--L--H--T--V--C--E--E--A--R--C--P--N--I--G--E--C--W--G--G--G--E--Y--A--T--A--T--A--T--I--M--L--M--
AATCTCCATACAGTATGTGAGGAAGCTCGATGTCCCAATATTGGAGAGTGTTGGGGAGGTGGAGAATATGCCACCGCCACAGCCACGATCATGTTGATGG
:::::::::   ::.::::::::::::::::::::.::::::::::::::.::::::::.::::::::::::::.::.::::::::.:::::::::::::
AATCTCCAT---GTGTGTGAGGAAGCTCGATGTCCTAATATTGGAGAGTGCTGGGGAGGCGGAGAATATGCCACTGCTACAGCCACAATCATGTTGATGG
-N--L--H-----V--C--E--E--A--R--C--P--N--I--G--E--C--W--G--G--G--E--Y--A--T--A--T--A--T--I--M--L--M--

----------------------------------------------------------------------------------------------------
G--D--T--C--T--R--G--C--R--F--C--S--V--K--T--A--R--N--P--P--P--L--D--A--S--E--P--Y--N--T--A--K--A--I
GTGACACATGTACAAGAGGTTGCAGATTTTGTTCTGTTAAGACTGCAAGAAATCCTCCTCCACTGGATGCCAGTGAGCCCTACAATACTGCAAAGGCAAT
::::.:::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::.:::::::::::::::.:::::::::::
GTGATACATGTACAAGAGGTTGCAGATTTTGTTCTGTTAAGACTGCAAGAAATCCACCTCCACTGGATGCCAATGAGCCCTACAATACCGCAAAGGCAAT
G--D--T--C--T--R--G--C--R--F--C--S--V--K--T--A--R--N--P--P--P--L--D--A--N--E--P--Y--N--T--A--K--A--I

-------------------------------------------------><-------------------------------------------------
--A--E--W--G--L--D--Y--V--V--L--T--S--V--D--R--D--D--M--P--D--G--G--A--E--H--I--A--K--T--V--S--Y--L-
TGCAGAATGGGGTCTGGATTATGTTGTCCTGACATCTGTGGATCGAGATGATATGCCTGATGGGGGAGCTGAACACATTGCAAAGACCGTATCATATTTA
:::::::::::::::::::::::::::::::::.:::::::::::::::   :::::::::::.::::::::.::: :::::::::::::::: ::.:::
TGCAGAATGGGGTCTGGATTATGTTGTCCTGACGTCTGTGGATCGAGAT---ATGCCTGATGGAGGAGCTGAGCACTTTGCAAAGACCGTATCTTACTTA
--A--E--W--G--L--D--Y--V--V--L--T--S--V--D--R--D-----M--P--D--G--G--A--E--H--F--A--K--T--V--S--Y--L-

-------><-------------------------------------------------------------------------------------------
-K--E--R--N--P--K--I--L--V--E--C--L--T--P--D--F--R--G--D--L--K--A--I--E--K--V--A--L--S--G--L--D--V--
AAGGAAAGGAATCCAAAAATCCTTGTGGAGTGTCTTACTCCTGATTTTCGAGGTGATCTCAAAGCAATAGAAAAAGTTGCTCTGTCAGGATTAGATGTGT
::::::   :::::::::::.::::::::.:::::.::.::::::::.::::: :::::.::::::.::::::::::::::::::: :::::::::::.:
AAGGAA---AATCCAAAAATTCTTGTGGAATGTCTCACCCCTGATTTCCGAGGAGATCTTAAAGCAGTAGAAAAAGTTGCTCTGTCCGGATTAGATGTAT
-K--E-----N--P--K--I--L--V--E--C--L--T--P--D--F--R--G--D--L--K--A--V--E--K--V--A--L--S--G--L--D--V--

------------------------------------><--------------------------------------------------------------
Y--A--H--N--V--E--T--V--P--E--L--Q--S--K--V--R--D--P--R--A--N--F--D--Q--S--L--R--V--L--K--H--A--K--K
ATGCACATAATGTAGAAACAGTCCCGGAATTACAGAGTAAGGTTCGTGATCCTCGGGCCAATTTTGATCAGTCCCTACGTGTACTGAAACATGCCAAGAA
::::::::::::::::::: ::.::::::::::::   ::.:::::::::::.:::::...:::.::.:::::.:::::.::::::::::::::::::.:
ATGCACATAATGTAGAAACTGTTCCGGAATTACAG---AAAGTTCGTGATCCCCGGGCTGGTTTCGACCAGTCTCTACGCGTACTGAAACATGCCAAGGA
Y--A--H--N--V--E--T--V--P--E--L--Q-----K--V--R--D--P--R--A--G--F--D--Q--S--L--R--V--L--K--H--A--K--E

----------------------------------------------------------------------------------><----------------
--V--Q--P--D--V--I--S--K--T--S--I--M--L--G--L--G--E--N--D--E--Q--V--Y--A--T--M--K--A--L--R--E--A--D-
GGTTCAGCCTGATGTTATTTCTAAAACATCTATAATGTTGGGTTTAGGCGAGAATGATGAGCAAGTATATGCAACAATGAAAGCACTTCGTGAGGCAGAT
:::::..:::::::::::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::::.::::::   ::::::::.::::::
GGTTCGACCTGATGTTATTTCTAAAACATCCATAATGTTGGGTTTAGGTGAGAATGATGAGCAAGTATATGCAACGATGAAA---CTTCGTGAAGCAGAT
--V--R--P--D--V--I--S--K--T--S--I--M--L--G--L--G--E--N--D--E--Q--V--Y--A--T--M--K-----L--R--E--A--D-

-----------------------------------------------------><---------------------------------------------
-V--D--C--L--T--L--G--Q--Y--M--Q--P--T--R--R--H--L--K--V--E--E--Y--I--T--P--E--K--F--K--Y--W--E--K--
GTAGACTGCTTGACTTTAGGACAATATATGCAGCCAACAAGGCGTCACCTTAAGGTTGAAGAATATATTACTCCTGAAAAATTCAAATACTGGGAAAAAG
::.:::::.:::::::::::::::::::::::::::::::.:::.:::::::::::.::::::::.::::::::::::::.:::::::::::::::::::
GTGGACTGTTTGACTTTAGGACAATATATGCAGCCAACAAAGCGCCACCTTAAGGTCGAAGAATACATTACTCCTGAAAAGTTCAAATACTGGGAAAAAG
-V--D--C--L--T--L--G--Q--Y--M--Q--P--T--K--R--H--L--K--V--E--E--Y--I--T--P--E--K--F--K--Y--W--E--K--

-----------------------------------------------------------------><---------------------------------
V--G--N--E--L--G--F--H--Y--T--A--S--G--P--L--V--R--S--S--Y--K--A--G--E--F--F--L--K--N--L--V--A--K--R
TAGGAAATGAACTTGGATTTCATTATACTGCAAGTGGCCCTTTGGTGCGTTCTTCATATAAAGCAGGTGAATTTTTCCTGAAAAATCTAGTGGCTAAAAG
::::::::::::::::::::::::::::::: :::::::::.:::::::::::::::::::::::   ::::::::::::::::::::::::::::::::
TAGGAAATGAACTTGGATTTCATTATACTGCCAGTGGCCCTCTGGTGCGTTCTTCATATAAAGCA---GAATTTTTCCTGAAAAATCTAGTGGCTAAAAG
V--G--N--E--L--G--F--H--Y--T--A--S--G--P--L--V--R--S--S--Y--K--A-----E--F--F--L--K--N--L--V--A--K--R

------------------>
--K--T--K--D--L--*-
AAAAACAAAAGACCTCTAA
::::::::::: :::::::
AAAAACAAAAGCCCTCTAA
--K--T--K--A--L--*-

Pig Consensus Sequence

>BGISUST0000897085
---------------------------------------------------------------TGCAGTCCAGTCAGAGCAATAAGTTCCTTGCCAGATA
AAAAAAAGGAATTTTTACAGAATGGACCAGACCTTCAAGATTTTCTATCTGGTGATCTTGCAGACAAGAGCACCTGGGATGACTATAAAGGAAACCTAAA
ACGCCAGAAAGGAGAA---TTAAGACTACCTCCATGGCTAAAGACAGAGATTCCCATGGGGAAAAATTACAATAGACTGAAGAATACATTGCGGAATTTA
AATCTCCAT---GTGTGTGAGGAAGCTCGATGTCCTAATATTGGAGAGTGCTGGGGAGGCGGAGAATATGCCACTGCTACAGCCACAATCATGTTGATGG
GTGATACATGTACAAGAGGTTGCAGATTTTGTTCTGTTAAGACTGCAAGAAATCCACCTCCACTGGATGCCAATGAGCCCTACAATACCGCAAAGGCAAT
TGCAGAATGGGGTCTGGATTATGTTGTCCTGACGTCTGTGGATCGAGAT---ATGCCTGATGGAGGAGCTGAGCACTTTGCAAAGACCGTATCTTACTTA
AAGGAA---AATCCAAAAATTCTTGTGGAATGTCTCACCCCTGATTTCCGAGGAGATCTTAAAGCAGTAGAAAAAGTTGCTCTGTCCGGATTAGATGTAT
ATGCACATAATGTAGAAACTGTTCCGGAATTACAG---AAAGTTCGTGATCCCCGGGCTGGTTTCGACCAGTCTCTACGCGTACTGAAACATGCCAAGGA
GGTTCGACCTGATGTTATTTCTAAAACATCCATAATGTTGGGTTTAGGTGAGAATGATGAGCAAGTATATGCAACGATGAAA---CTTCGTGAAGCAGAT
GTGGACTGTTTGACTTTAGGACAATATATGCAGCCAACAAAGCGCCACCTTAAGGTCGAAGAATACATTACTCCTGAAAAGTTCAAATACTGGGAAAAAG
TAGGAAATGAACTTGGATTTCATTATACTGCCAGTGGCCCTCTGGTGCGTTCTTCATATAAAGCA---GAATTTTTCCTGAAAAATCTAGTGGCTAAAAG
AAAAACAAAAGCCCTCTAA


>BGISUSP0000897085
---------------------CSPVRAISSLPDKKKEFLQNGPDLQDFLSGDLADKSTWDDYKGNLKRQKGE-LRLPPWLKTEIPMGKNYNRLKNTLRNL
NLH-VCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPYNTAKAIAEWGLDYVVLTSVDRD-MPDGGAEHFAKTVSYL
KE-NPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQ-KVRDPRAGFDQSLRVLKHAKEVRPDVISKTSIMLGLGENDEQVYATMK-LREAD
VDCLTLGQYMQPTKRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKA-EFFLKNLVAKRKTKAL*