Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000078177 (click for geneview)
Transcript ID ENST00000261435(link to ensembl)
Symbol N4BP2_HUMAN
Localtion Chromosome:4:39897720:39979583:1 band: 4p14
Description Nedd4-binding protein 2 (EC 3.-.-.-) (N4BP2) (BCL-3 binding protein).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--R--R--R--K--N--L--G--G--N--P--F--R--K--T--A--N--P--K--E--V--V--V--S--S--V--A--S--R--E--E--P--
ATGCCAAGGAGAAGGAAAAATCTTGGGGGAAATCCTTTTCGGAAGACTGCAAACCCTAAGGAAGTTGTCGTATCCAGTGTTGCTAGTCGTGAGGAGCCAA
:::::::::::::::::.::::::::::::::::::::::::::::::                                                    
ATGCCAAGGAGAAGGAAGAATCTTGGGGGAAATCCTTTTCGGAAGACT----------------------------------------------------
-M--P--R--R--R--K--N--L--G--G--N--P--F--R--K--T-----------------------------------------------------

----------------------------------------------------------------------------------------------------
T--T--T--L--P--S--M--G--E--T--K--V--D--Q--E--E--L--F--T--S--I--S--E--I--F--S--D--L--D--P--D--V--V--Y
CCACTACTCTACCTTCCATGGGTGAGACAAAAGTTGATCAGGAAGAACTCTTCACCAGTATCTCAGAGATATTTTCTGATCTGGATCCTGATGTAGTGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------><----------------------------------------------------------------------
--L--M--L--S--E--C--D--F--K--V--E--N--A--M--D--C--L--L--E--L--S--A--T--D--T--K--I--E--E--S--S--S--Q-
TTTGATGCTTTCTGAATGTGATTTCAAAGTTGAAAATGCTATGGATTGTCTATTAGAATTATCTGCCACTGATACCAAGATAGAAGAATCATCTTCACAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--F--V--A--S--E--N--Q--V--G--A--A--E--S--K--I--M--E--K--R--P--E--E--E--S--E--D--S--K--M--D--S--F--
AGTTTCGTTGCTTCTGAGAACCAAGTAGGTGCAGCAGAAAGTAAAATAATGGAAAAACGTCCTGAAGAAGAGAGTGAAGATTCAAAAATGGATTCATTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--D--M--Q--L--T--E--D--L--D--S--L--I--Q--N--A--F--E--K--L--N--S--S--P--D--D--Q--V--Y--S--F--L--P--S
TGGACATGCAGCTAACTGAAGACCTGGATTCCTTAATACAGAATGCTTTTGAGAAATTGAACTCTTCTCCTGATGACCAAGTATACTCATTTTTGCCTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--D--V--N--S--F--N--D--S--S--E--F--I--N--P--D--S--S--N--M--T--P--I--F--S--T--Q--N--M--N--L--N--G-
ACAAGATGTTAATAGTTTTAATGACTCAAGTGAGTTTATAAATCCTGATTCAAGTAATATGACTCCCATTTTTTCTACACAAAATATGAATTTGAACGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--N--L--E--N--S--G--S--T--L--S--L--N--P--L--P--S--H--S--V--L--N--E--S--K--C--F--I--K--D--N--T--L--
GAAAATTTAGAGAATTCTGGTTCTACTTTAAGTTTAAACCCATTACCTTCACATTCAGTTTTGAACGAGTCCAAGTGTTTTATAAAGGATAACACATTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--L--E--S--N--Y--P--E--D--S--L--L--S--S--S--L--N--V--A--S--D--S--I--A--G--C--S--S--L--N--Q--K--Q--K
CTTTGGAAAGTAACTACCCGGAAGATTCTCTTCTCAGTAGTTCTTTAAATGTAGCAAGTGACTCCATCGCAGGTTGTAGCAGTCTCAATCAAAAACAGAA
                                                                                      :.:::::  ::::.
--------------------------------------------------------------------------------------AGTCAAATTCAGAG
---------------------------------------------------------------------------------------S--Q--I--Q--R

----------------------------------------------------------------------------------------------------
--E--L--L--E--S--E--C--V--E--A--Q--F--S--E--A--P--V--D--L--D--A--S--E--P--Q--A--C--L--N--L----------
AGAACTTTTAGAATCTGAGTGCGTTGAGGCTCAATTCTCTGAAGCTCCTGTAGATTTGGATGCCAGTGAACCTCAGGCTTGTTTAAACCTT---------
:::.:::::::::::::::::.::::::.:.::.:::::: ::::.::::::::::.::::::::::::::.:::::::. ::::::::::         
AGAGCTTTTAGAATCTGAGTGTGTTGAGACCCAGTTCTCTCAAGCCCCTGTAGATTCGGATGCCAGTGAACTTCAGGCTCCTTTAAACCTTACTGTGCAA
--E--L--L--E--S--E--C--V--E--T--Q--F--S--Q--A--P--V--D--S--D--A--S--E--L--Q--A--P--L--N--L--T--V--Q-

----------------------------------------------------------------------------------------------------
----P--G--L--D--L--P--G--T--G--G--D--Q--K--S--T--R--V--S--D--V--F--L--P--S--E--G--F--N--F--K--P--H--
---CCAGGGCTTGATTTACCAGGTACAGGTGGGGATCAGAAATCTACTCGGGTCTCTGATGTGTTTCTACCTTCCGAAGGGTTCAACTTCAAGCCACACA
   ::.:::::::.:::::.::::::::::::::::::::::::.:::.  ::::::::::: ::: ::::: :.::::..:::: .::: :::::::::
AACCCGGGGCTTGGTTTACTAGGTACAGGTGGGGATCAGAAATCCACTTCTGTCTCTGATGTTTTTGTACCTGCTGAAGAATTCACTTTCCAGCCACACA
-N--P--G--L--G--L--L--G--T--G--G--D--Q--K--S--T--S--V--S--D--V--F--V--P--A--E--E--F--T--F--Q--P--H--

----------------------------------------------------------------------------------------------------
K--H--P--E--L--P--T--K--G--K--D--V--S--Y--C--P--V--L--A--P--L--P--L--L--L--P--P--P--P--P--P--P--M--W
AACATCCTGAACTGCCAACTAAGGGGAAGGATGTGAGTTACTGCCCGGTACTTGCTCCTCTCCCATTGCTGTTGCCTCCTCCGCCACCTCCACCGATGTG
::: : ::::::::::: : ::::::::::::::::..::::::::.::::::.:.:::::::: .:..::.:::::::::: :: ::::::::.:::::
AACCTGCTGAACTGCCACCAAAGGGGAAGGATGTGAACTACTGCCCAGTACTTACCCCTCTCCCTCTATTGCTGCCTCCTCCTCCCCCTCCACCAATGTG
K--P--A--E--L--P--P--K--G--K--D--V--N--Y--C--P--V--L--T--P--L--P--L--L--L--P--P--P--P--P--P--P--M--W

----------------------------------------------------------------------------------------------------
--N--P--M--I--P--A--F--D--L--F--Q--G--N--H--G--F--V--A--P--V--V--T--T--A--A--H--W--R--S--V--N--Y--T-
GAATCCAATGATTCCTGCTTTTGACCTCTTCCAAGGAAACCATGGCTTTGTAGCTCCTGTTGTAACCACAGCTGCACACTGGAGATCTGTCAACTACACA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::.::::::::::.:::
GAATCCAATGATTCCTGCTTTTGACCTCTTCCAAGGAAACCATGGCTTTGTAGCTCCCGTTGTAACCACAGCTGCACACTGGAGACCTGTCAACTATACA
--N--P--M--I--P--A--F--D--L--F--Q--G--N--H--G--F--V--A--P--V--V--T--T--A--A--H--W--R--P--V--N--Y--T-

----------------------------------------------------------------------------------------------------
-F--P--P--S--V--I--S--H--T--S--P--T--K--V--W--R--N--K--D--G--T--S--A--Y--Q--V--Q--E--T--P--V--S--Q--
TTTCCACCCTCAGTTATTTCTCACACTTCCCCAACAAAAGTATGGAGAAATAAAGATGGAACAAGTGCTTATCAAGTACAAGAAACCCCAGTTTCTCAGG
::::::.::.:::::::.::::::::::::::::::::.: ::::::.:::::.:: ::: ::::::::::::::.::::::::.:.:::::::::::::
TTTCCATCCCCAGTTATCTCTCACACTTCCCCAACAAAGGGATGGAGGAATAAGGAGGGATCAAGTGCTTATCAAATACAAGAAGCTCCAGTTTCTCAGG
-F--P--S--P--V--I--S--H--T--S--P--T--K--G--W--R--N--K--E--G--S--S--A--Y--Q--I--Q--E--A--P--V--S--Q--

---------------------------------------------------------------------------------------><-----------
V--V--R--K--K--T--S-----Y--V--G--L--V--L--V--L--L--R--G--L--P--G--S--G--K--S--F--L--A--R--T--L--Q--E
TTGTAAGAAAGAAGACATCT---TACGTTGGACTAGTTCTTGTTCTTCTCAGAGGTCTTCCGGGATCTGGAAAATCTTTTTTGGCAAGGACTTTGCAAGA
:::::::::::::::::::    ::.::::::::::::::::::::::::::::: ::::::::::: ::::::::::::::::::   :::::::::::
TTGTAAGAAAGAAGACATCATCTTATGTTGGACTAGTTCTTGTTCTTCTCAGAGGGCTTCCGGGATCAGGAAAATCTTTTTTGGCA---ACTTTGCAAGA
V--V--R--K--K--T--S--S--Y--V--G--L--V--L--V--L--L--R--G--L--P--G--S--G--K--S--F--L--A-----T--L--Q--E

----------------------------------------------------------------------------------------------------
--D--N--P--S--G--V--I--L--S--T--D--D--Y--F--Y--I--N--G--Q--Y--Q--F--D--V--K--Y--L--G--E--A--H--E--W-
GGATAATCCAAGTGGAGTCATTCTTAGTACTGATGATTATTTTTATATAAATGGACAGTACCAGTTTGATGTAAAGTACTTAGGAGAAGCACATGAATGG
.:::::::::::::::::::::::::::::::::::::: :::::.:::::::::::::::::::::::::::                           
AGATAATCCAAGTGGAGTCATTCTTAGTACTGATGATTAGTTTTACATAAATGGACAGTACCAGTTTGATGTA---------------------------
--D--N--P--S--G--V--I--L--S--T--D--D--*--F--Y--I--N--G--Q--Y--Q--F--D--V----------------------------

------------><--------------------------------------------------------------------------------------
-N--Q--N--R--A--K--E--A--F--E--K--K--I--S--P--I--I--I--D--N--T--N--L--Q--A--W--E--M--K--P--Y--V--A--
AACCAGAATCGTGCAAAAGAAGCATTTGAGAAGAAGATATCTCCTATAATTATAGATAATACAAACCTACAGGCATGGGAAATGAAACCATATGTTGCTT
               :::::::::::::::::::::.:.:: :::::::: :::::::::::::::::::::::::::::::::::.:::::::::::::
---------------AAAGAAGCATTTGAGAAGAAGGTGTCACCTATAATAATAGATAATACAAACCTACAGGCATGGGAAATGAAGCCATATGTTGCTT
----------------K--E--A--F--E--K--K--V--S--P--I--I--I--D--N--T--N--L--Q--A--W--E--M--K--P--Y--V--A--

-><---------------------------------------------------------------------------><--------------------
L--S--Q--K--H--K--Y--K--V--L--F--R--E--P--D--T--W--W--K--F--K--P--K--E--L--A--R--R--N--I--H--G--V--S
TGTCTCAGAAACACAAATATAAAGTCCTTTTTCGGGAACCAGACACATGGTGGAAGTTTAAACCAAAGGAACTTGCAAGGCGTAACATTCATGGGGTAAG
:::::::.: :::.:::::::::::::::::.::::::::. :.:::::::::::.::.::::::::::::::::::                       
TGTCTCAAACACATAAATATAAAGTCCTTTTCCGGGAACCGTATACATGGTGGAAATTCAAACCAAAGGAACTTGCA-----------------------
L--S--Q--T--H--K--Y--K--V--L--F--R--E--P--Y--T--W--W--K--F--K--P--K--E--L--A------------------------

----------------------------------------------------------------------------------------------------
--K--E--K--I--T--R--M--L--E--H--Y--Q--R--F--V--S--V--P--I--I--M--S--S--S--V--P--E--K--I--E--R--I--E-
CAAAGAAAAAATAACAAGAATGTTGGAACATTATCAACGTTTTGTTTCAGTGCCAATAATTATGAGTTCTTCGGTTCCAGAGAAAATTGAACGTATTGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------><----------------------------------------------------------------
-L--C--A--Y--S--C--E--D--R--S--T--S--P--R--D--D--E--D--I--I--S--E--K--E--E--N--I--L--S--L--S--L--K--
TTGTGTGCATATTCTTGTGAGGATAGAAGCACTAGCCCAAGAGACGATGAAGATATTATCTCTGAAAAAGAAGAAAATATTTTATCTTTATCTTTGAAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--L--E--F--T--E--E--K--N--L--D--V--T--K--E--T--M--L--P--E--N--V--A--Y--L--S--N--A--D--L--N--K--R--R
ATCTAGAGTTCACTGAAGAGAAGAATCTTGATGTAACCAAAGAAACAATGTTACCTGAGAATGTTGCATATCTCTCTAATGCAGATTTAAACAAAAGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--E--I--S--D--M--N--P--S--I--Q--S--A--L--I--L--E--T--P--H--M--Y--F--S--D--S--E--S--K--L--Q--A--T-
AAAAGAAATAAGTGATATGAATCCTAGCATTCAAAGTGCTTTAATTCTGGAAACTCCACACATGTATTTTTCTGACTCTGAAAGCAAACTACAGGCAACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--K--S--E--N--E--Q--I--E--M--V--A--V--K--G--Y--S--K--T--D--T--D--S--S--M--E--R--V--S--P--S--T--C--
GACAAAAGTGAAAACGAGCAAATAGAAATGGTGGCTGTAAAAGGGTATAGTAAAACTGACACAGATAGTTCTATGGAGAGAGTATCACCTAGTACTTGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
C--S--E--N--N--Q--E--D--C--D--L--A--N--S--G--P--L--Q--N--E--K--S--S--P--G--E--I--V--E--E--R--A--T--V
GTAGTGAAAATAATCAAGAAGACTGTGATCTTGCAAATAGTGGACCACTTCAAAATGAAAAATCCTCACCTGGTGAAATAGTGGAAGAAAGAGCAACAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--K--K--A--F--G--K--Q--K--S--K--S--T--L--E--K--F--P--R--H--E--L--S--N--F--V--G--D--W--P--V--D--K-
AACGAAAAAAGCCTTTGGGAAACAAAAAAGCAAATCGACTTTGGAAAAGTTCCCAAGACATGAGCTATCAAATTTTGTTGGTGACTGGCCAGTTGATAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--I--G--Q--R--T--K--R--N--R--K--T--E--K--T--S--S--V--Q--S--D--K--K--Y--N--Y--P--Q--S--H--K--L--V--
ACTATTGGTCAGAGGACAAAAAGGAACAGAAAAACTGAAAAAACTTCATCCGTACAAAGCGACAAAAAGTATAATTACCCTCAGTCACACAAATTAGTTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--S--V--S--V--N--T--D--C--V--Q--Q--R--G--S--P--H--E--S--V--E--D--G--R--K--S--Q--C--D--D--A--S--E--P
ACAGTGTATCTGTGAATACAGATTGTGTCCAGCAACGAGGATCTCCACATGAAAGTGTAGAGGATGGCAGAAAGTCACAGTGTGATGATGCTTCAGAGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--N--S--Y--K--Y--D--A--Y--K--N--I--D--K--N--S--F--N--I--M--G--D--W--P--S--S--D--S--L--A--Q--R--E-
ACTCAATAGCTATAAATATGATGCTTATAAAAATATTGACAAAAACTCATTCAACATTATGGGTGACTGGCCTTCATCTGATTCTTTAGCTCAGAGGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-H--R--S--R--M--P--K--T--G--L--S--E--P--N--L--E--I--G--T--N--D--K--M--N--E--I--S--L--S--T--A--H--E--
CACAGATCAAGAATGCCAAAGACTGGTTTAAGTGAGCCCAACCTAGAAATTGGAACAAATGACAAAATGAATGAAATATCCTTATCTACAGCACATGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--C--W--G--T--S--S--Q--K--L--K--T--L--G--S--S--N--L--G--S--S--E--M--L--L--S--E--M--T--C--E--S--Q--T
CCTGTTGGGGCACAAGCTCTCAAAAACTAAAGACATTGGGTAGCTCCAATCTAGGAAGTTCTGAAATGCTGCTCAGTGAAATGACCTGTGAGAGTCAGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--C--L--S--K--K--S--H--G--Q--H--T--S--L--P--L--T--F--T--N--S--A--P--T--V--S--G--V--V--E--P--Q--T--L-
TTGTCTAAGTAAAAAGAGTCATGGGCAACACACATCGTTGCCTCTTACTTTTACCAATAGTGCACCAACTGTTTCTGGAGTAGTAGAACCACAAACGTTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--E--C--Q--E--Q--M--P--K--R--D--P--G--K--E--V--G--M--C--T--Q--T--E--P--Q--D--F--A--L--L--W--K--I--
GCTGAATGTCAAGAGCAAATGCCTAAGAGAGACCCTGGAAAAGAAGTAGGCATGTGCACCCAGACTGAACCACAGGATTTTGCTCTTTTATGGAAAATAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--K--N--K--I--S--I--S--D--S--I--K--V--L--T--G--R--L--D--G--F--K--P--K--V--F--N--I--N--T--K--S--D--V
AAAAGAATAAAATTAGCATTTCAGATTCTATCAAAGTATTAACAGGAAGATTAGATGGATTTAAGCCGAAAGTTTTCAATATTAACACAAAATCAGACGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--E--A--I--P--Y--R--V--M--Y--D--K--S--T--F--V--E--E--S--E--L--T--S--A--D--E--S--E--N--L--N--I--L-
TCAAGAAGCAATTCCATATAGAGTAATGTATGATAAAAGCACGTTTGTTGAAGAAAGTGAGCTTACCAGTGCAGATGAATCTGAAAATCTTAACATTCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-C--K--L--F--G--S--F--S--L--E--A--L--K--D--L--Y--E--R--C--N--K--D--I--I--W--A--T--S--L--L--L--D--S--
TGTAAACTGTTTGGATCCTTTTCATTAGAAGCCCTGAAAGACTTATATGAGAGGTGCAATAAAGATATTATTTGGGCCACAAGCCTTTTGTTGGATTCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--T--K--L--C--E--D--T--E--F--E--N--F--Q--K--S--C--D--G--S--Q--I--G--P--F--S--L--G--L--N--L--K--E--I
AAACTAAGTTATGTGAGGATACAGAGTTTGAGAATTTCCAAAAATCGTGTGATGGATCACAAATTGGGCCTTTTTCTCTGGGGTTGAATTTGAAAGAAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--I--S--Q--R--G--T--L--E--N--S--N--S--P--V--P--E--F--S--H--G--I--G--I--S--N--A--D--S--Q--S--T--C--D-
TATTAGCCAAAGAGGAACTTTAGAGAATTCTAATTCTCCTGTGCCAGAGTTTAGCCATGGGATTGGTATTAGTAACGCTGACTCACAGTCTACTTGTGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--E--R--G--N--S--E--Q--A--E--M--R--A--V--T--P--E--N--H--E--S--M--T--S--I--F--P--S--A--A--V--G--L--
GCAGAAAGAGGAAACTCAGAGCAGGCGGAAATGAGAGCTGTCACTCCTGAAAACCATGAATCGATGACAAGTATATTTCCCAGTGCTGCTGTGGGTCTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--N--N--N--D--I--L--P--N--S--Q--E--E--L--L--Y--S--S--K--Q--S--F--P--G--I--L--K--A--T--T--P--K--D--M
AGAATAATAATGACATACTTCCTAACAGCCAGGAAGAACTTTTATATAGCAGTAAGCAGTCCTTTCCAGGTATTCTAAAAGCTACTACTCCTAAAGATAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--E--T--E--K--N--L--V--V--T--E--T--G--D--N--I--H--S--P--S--H--F--S--D--I--F--N--F--V--S--S--T--S-
GAGTGAAACAGAAAAAAACCTAGTAGTCACAGAGACTGGAGACAACATACATTCTCCTTCACATTTCTCTGATATTTTTAACTTTGTATCTAGTACTTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--L--E--L--N--E--E--I--Y--F--T--D--S--L--E--I--K--R--N--E--N--F--P--K--D--Y--V--K--F--S--D--E--E--
AATCTTGAATTAAATGAAGAAATTTATTTTACTGATTCTCTTGAAATAAAGAGAAATGAAAATTTTCCAAAGGATTATGTGAAATTTTCAGATGAAGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--F--M--N--E--D--E--K--E--M--K--E--I--L--M--A--G--S--S--L--S--A--G--V--S--G--E--D--K--T--E--I--L--N
AATTTATGAATGAAGATGAGAAGGAAATGAAGGAAATTCTAATGGCAGGAAGTAGTTTATCAGCTGGAGTTAGTGGGGAAGATAAAACCGAGATATTGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--T--P--A--M--A--K--S--L--T--I--D--C--L--E--L--A--L--P--P--E--L--A--F--Q--L--N--E--L--F--G--P--V-
TCCCACTCCAGCGATGGCCAAATCTCTGACCATAGACTGTCTGGAATTGGCATTACCCCCTGAACTGGCTTTTCAACTTAATGAATTATTTGGTCCTGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><------------------------------------------------------------------------------------><
-G--I--D--S--G--S--L--T--V--E--D--C--V--V--H--I--D--L--N--L--A--K--V--I--H--E--K--W--K--E--S--V--M--
GGTATTGATTCAGGGTCTCTAACAGTTGAAGATTGTGTGGTTCATATAGATCTGAATCTGGCGAAAGTGATTCATGAGAAATGGAAAGAATCTGTAATGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------><------------------------------------------------------
E--R--Q--R--Q--E--E--V--S--C--G--K--F--M--Q--D--P--S--L--V--G--H--T--G--L--D--N--P--E--Q--K--S--S--Q
AGCGACAAAGACAAGAAGAGGTGTCTTGTGGCAAGTTTATGCAAGATCCTTCCTTGGTTGGACATACTGGGCTTGATAATCCTGAACAAAAATCATCTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--T--G--K--K--L--L--K--T--L--T--A--S--E--M--L--P--L--L--D--H--W--N--T--Q--T--K--K--V--S--L--R--E-
GAGAACAGGCAAAAAATTACTGAAGACTTTAACAGCATCTGAAATGCTACCTTTATTGGATCATTGGAATACTCAAACTAAAAAAGTATCACTCAGAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------><---------------------------------------------------------
-I--M--S--E--E--I--A--L--Q--E--K--H--N--L--K--R--E--T--L--M--F--E--K--D--C--A--T--K--L--K--E--K--Q--
ATAATGTCAGAAGAAATTGCCTTACAGGAAAAACATAATTTGAAAAGGGAGACCCTTATGTTTGAAAAAGATTGTGCCACTAAACTAAAGGAGAAGCAGC
                                          ::::::::::: :::::::::::: ::::::::::::::::.::::::::::::::::
------------------------------------------AAAAGGGAGACACTTATGTTTGAACAAGATTGTGCCACTAAGCTAAAGGAGAAGCAGC
-------------------------------------------K--R--E--T--L--M--F--E--Q--D--C--A--T--K--L--K--E--K--Q--

---------------------------------------------------------------><-----------------------------------
L--F--K--I--F--P--A--I--N--Q--N--F--L--V--D--I--F--K--D--H--N--Y--S--L--E--H--T--V--Q--F--L--N--C--V
TCTTTAAGATATTTCCAGCCATTAACCAAAATTTTCTGGTGGACATTTTCAAGGACCACAACTATTCATTAGAACACACAGTGCAATTTCTTAACTGTGT
:::::::::::::::::::::: :::::::::::::::                        ::::: .:::::::::::::::::::::: ::.:::::
TCTTTAAGATATTTCCAGCCAT-AACCAAAATTTTCTG------------------------TATTCTCTAGAACACACAGTGCAATTTCTAAATTGTGT
L--F--K--I--F--P--A--I--N--Q--N--F--L--------------------------Y--S--L--E--H--T--V--Q--F--L--N--C--V

----------------------------------------------------------------------------------------------------
--L--E--G--D--P--V--K--T--V--V-----A--Q--E--F--V--H--Q--N--E--N--V--T--S--H--T--G--Q--K--S--K--E--K-
TCTTGAAGGGGACCCTGTAAAAACAGTTGTA---GCCCAAGAGTTTGTTCACCAAAATGAGAATGTCACATCTCATACTGGCCAGAAGTCTAAAGAGAAA
:::::::::.:::::::::::::::::::::   :: ::::::::::::::::::::.::::::::::: ::::::::::  :::::::::::.::::::
TCTTGAAGGAGACCCTGTAAAAACAGTTGTAA--GCGCAAGAGTTTGTTCACCAAAACGAGAATGTCACTTCTCATACTGCACAGAAGTCTAAGGAGAAA
--L--E--G--D--P--V--K--T--V--V--\--A--Q--E--F--V--H--Q--N--E--N--V--T--S--H--T--A--Q--K--S--K--E--K-

-----><---------------------------------------------------------------------------------------------
-K--P--K--K--L--K--E--T--E--E--T--P--S--E--L--S--F--Q--D--F--E--Y--P--D--Y--D--D--Y--R--A--E--A--F--
AAGCCAAAGAAATTAAAAGAGACTGAAGAAACACCAAGTGAACTGTCTTTCCAGGACTTTGAGTACCCAGACTATGATGACTACAGAGCAGAGGCTTTCC
:::                                                      ::::::::::: :: ::::::::::::::.::::::::::::.
AAG------------------------------------------------------TTTGAGTACCCCGAGTATGATGACTACAGGGCAGAGGCTTTCT
-K--------------------------------------------------------F--E--Y--P--E--Y--D--D--Y--R--A--E--A--F--

----------------------------------------------------------------------------------------------><----
L--H--Q--Q--K--R--M--E--C--Y--S--K--A--K--E--A--Y--R--I--G--K--K--N--V--A--T--F--Y--A--Q--Q--G--T--L
TTCACCAACAGAAGAGGATGGAGTGCTACAGCAAGGCCAAAGAAGCTTATCGGATAGGGAAAAAAAATGTCGCCACCTTTTATGCCCAGCAGGGTACTCT
: :::::.:::::::::::.::.:::::::::::::: :::::::::::::::::.:::::.:::::::: ::::: ::::::::::::::::::: :::
TGCACCAGCAGAAGAGGATAGAATGCTACAGCAAGGCGAAAGAAGCTTATCGGATGGGGAAGAAAAATGTGGCCACGTTTTATGCCCAGCAGGGTAGTCT
L--H--Q--Q--K--R--I--E--C--Y--S--K--A--K--E--A--Y--R--M--G--K--K--N--V--A--T--F--Y--A--Q--Q--G--S--L

----------------------------------------------------------------------------------------------------
--H--E--Q--K--M--K--E--A--N--H--L--A--A--I--E--I--F--E--K--V--N--A--S--L--L--P--Q--N--V--L--D--L--H-
TCATGAGCAGAAGATGAAAGAAGCCAATCACCTTGCTGCCATAGAGATCTTTGAGAAAGTCAATGCTTCGCTGCTGCCACAGAATGTTTTAGACCTCCAT
::::::::::::::::::::::::::::::::::::::::.:.:::::::::::::::::::::::.:: :::::::: :::::::::::::::::::::
TCATGAGCAGAAGATGAAAGAAGCCAATCACCTTGCTGCCGTGGAGATCTTTGAGAAAGTCAATGCCTCCCTGCTGCCCCAGAATGTTTTAGACCTCCAT
--H--E--Q--K--M--K--E--A--N--H--L--A--A--V--E--I--F--E--K--V--N--A--S--L--L--P--Q--N--V--L--D--L--H-

---------------------------------------------------------------><-----------------------------------
-G--L--H--V--D--E--A--L--E--H--L--M--R--V--L--E--K--K--T--E--E--F--K--Q--N--G--G--K--P--Y--L--S--V--
GGGCTGCATGTGGATGAAGCTCTAGAACATTTGATGAGAGTTTTAGAGAAGAAGACTGAAGAATTTAAGCAGAACGGTGGGAAGCCCTATTTGTCTGTGA
:::::::::::::::.:.::: : :::::.::::.:: ::::::: :: ::::.::::::                                        
GGGCTGCATGTGGATAAGGCTATTGAACACTTGACGACAGTTTTACAGCAGAAAACTGAA----------------------------------------
-G--L--H--V--D--K--A--I--E--H--L--T--T--V--L--Q--Q--K--T--E-----------------------------------------

---------------------------------------------------------------------------------------><-----------
I--T--G--R--G--N--H--S--Q--G--G--V--A--R--I--K--P--A--V--I--K--Y--L--I--S--H--S--F--R--F--S--E--I--K
TTACGGGGAGAGGAAACCACAGCCAGGGAGGAGTTGCTCGCATCAAACCAGCTGTCATTAAGTACCTCATAAGCCATAGCTTCAGGTTCTCTGAAATTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------
--P--G--C--L--K--V--M--L--K--*-
ACCAGGGTGCTTGAAAGTCATGCTAAAGTAA
                               
-------------------------------
-------------------------------

Pig Consensus Sequence

>BGISUST0000902258
ATGCCAAGGAGAAGGAAGAATCTTGGGGGAAATCCTTTTCGGAAGACT----------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------AGTCAAATTCAGAG
AGAGCTTTTAGAATCTGAGTGTGTTGAGACCCAGTTCTCTCAAGCCCCTGTAGATTCGGATGCCAGTGAACTTCAGGCTCCTTTAAACCTTACTGTGCAA
AACCCGGGGCTTGGTTTACTAGGTACAGGTGGGGATCAGAAATCCACTTCTGTCTCTGATGTTTTTGTACCTGCTGAAGAATTCACTTTCCAGCCACACA
AACCTGCTGAACTGCCACCAAAGGGGAAGGATGTGAACTACTGCCCAGTACTTACCCCTCTCCCTCTATTGCTGCCTCCTCCTCCCCCTCCACCAATGTG
GAATCCAATGATTCCTGCTTTTGACCTCTTCCAAGGAAACCATGGCTTTGTAGCTCCCGTTGTAACCACAGCTGCACACTGGAGACCTGTCAACTATACA
TTTCCATCCCCAGTTATCTCTCACACTTCCCCAACAAAGGGATGGAGGAATAAGGAGGGATCAAGTGCTTATCAAATACAAGAAGCTCCAGTTTCTCAGG
TTGTAAGAAAGAAGACATCATCTTATGTTGGACTAGTTCTTGTTCTTCTCAGAGGGCTTCCGGGATCAGGA---ACTTTGCAAGAAGATAATCCAAGTGG
AGTCATTCTTAGTACTGATGATTAGTTTTACATAAATGGACAGTACCAGTTTGATGTA------------------------------------------
AAAGAAGCATTTGAGAAGAAGGTGTCACCTATAATAATAGATAATACAAACCTACAGGCATGGGAAATGAAGCCATATGTTGCTTTGTCTCAAACACATA
AATATAAAGTCCTTTTCCGGGAACCGTATACATGGTGGAAATTCAAACCAAAGGAACTTGCA--------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------AAAAGGGAGACACTTATGTTTGAACAAGATTGTGCCACTAAGCTAAAGGAGAAGCAGCTCTTTAAGATATTTC
CAGCcaACCAAAATTTTCTG------------------------TATTCTCTAGAACACACAGTGCAATTTCTAAATTGTGTTCTTGAAGGAGACCCTGT
AAAAACAGTTGTagCGCAAGAGTTTGTTCACCAAAACGAGAATGTCACTTCTCATACTGCACAGAAGTCTAAGGAGAAAAAG------------------
------------------------------------TTTGAGTACCCCGAGTATGATGACTACAGGGCAGAGGCTTTCTTGCACCAGCAGAAGAGGATAG
AATGCTACAGCAAGGCGAAAGAAGCTTATCGGATGGGGAAGAAAAATGTGGCCACGTTTTATGCCCAGCAGGGTAGTCTTCATGAGCAGAAGATGAAAGA
AGCCAATCACCTTGCTGCCGTGGAGATCTTTGAGAAAGTCAATGCCTCCCTGCTGCCCCAGAATGTTTTAGACCTCCATGGGCTGCATGTGGATAAGGCT
ATTGAACACTTGACGACAGTTTTACAGCAGAAAACTGAA-------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------


>BGISUSP0000902258
MPRRRKNLGGNPFRKT------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------SQIQRELLESECVETQFSQAPVDSDASELQAPLNLTVQ
NPGLGLLGTGGDQKSTSVSDVFVPAEEFTFQPHKPAELPPKGKDVNYCPVLTPLPLLLPPPPPPPMWNPMIPAFDLFQGNHGFVAPVVTTAAHWRPVNYT
FPSPVISHTSPTKGWRNKEGSSAYQIQEAPVSQVVRKKTSSYVGLVLVLLRGLPGSG-TLQEDNPSGVILSTDD*FYINGQYQFDV--------------
KEAFEKKVSPIIIDNTNLQAWEMKPYVALSQTHKYKVLFREPYTWWKFKPKELA----------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------KRETLMFEQDCATKLKEKQLFKIFPANQNFL--------YSLEHTVQFLNCVLEGDPVKTVVAQEFVHQNENVTSHTAQKSKEKK------
------------FEYPEYDDYRAEAFLHQQKRIECYSKAKEAYRMGKKNVATFYAQQGSLHEQKMKEANHLAAVEIFEKVNASLLPQNVLDLHGLHVDKA
IEHLTTVLQQKTE---------------------------------------------------------