Sequences
EST Library Info
nbm1Newborn 115 days, bone marrow (pelvis)
plac1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000009830 (click for geneview)
Transcript ID ENST00000261534(link to ensembl)
Symbol POMT2
Localtion Chromosome:14:76811054:76856978:-1 band: 14q24.3
Description Protein O-mannosyl-transferase 2 (EC 2.4.1.109) (Dolichyl-phosphate- mannose--protein mannosyltransferase 2). [Source:Uniprot/SWISSPROT;Acc:Q9UKY4]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--P--A--T--G--G--G--L--A--E--S--E--L--R--P--R--R--G--R--C--G--P--Q--A--A--R--A--A--G--R--D--V--
ATGCCGCCGGCCACGGGCGGAGGCCTGGCAGAGTCCGAGCTGCGTCCCCGGAGGGGCCGCTGTGGCCCCCAGGCTGCTAGGGCCGCAGGCCGGGACGTGG
:::::.::::: ..:::::::::::::::::.::::::::::::::::::::::::::::::::: .:::::::: : :::::::..:::  :::.:.::
ATGCCACCGGCGGTGGGCGGAGGCCTGGCAGGGTCCGAGCTGCGTCCCCGGAGGGGCCGCTGTGGGTCCCAGGCTCCAAGGGCCGTGGGCGCGGATGCGG
-M--P--P--A--V--G--G--G--L--A--G--S--E--L--R--P--R--R--G--R--C--G--S--Q--A--P--R--A--V--G--A--D--A--

----------------------------------------------------------------------------------------------------
A--A--E--A--V--A--R--S--P--K--R--P--A--W--G--S--R--R--F--E--A--V--G--W--W--A--L--L--A--L--V--T--L--L
CCGCTGAGGCTGTGGCGCGAAGCCCCAAACGGCCTGCTTGGGGCTCACGGCGCTTCGAGGCGGTCGGCTGGTGGGCCCTGCTGGCCTTGGTGACGCTGCT
:.::.:::.::...:::::.::::::::::::::::.:. ::::::.:::::::::::::::::::::..::::::.::.::::::.::::::::::. :
CTGCCGAGACTACAGCGCGGAGCCCCAAACGGCCTGTTCCGGGCTCGCGGCGCTTCGAGGCGGTCGGCCAGTGGGCTCTACTGGCCCTGGTGACGCTAAT
A--A--E--T--T--A--R--S--P--K--R--P--V--P--G--S--R--R--F--E--A--V--G--Q--W--A--L--L--A--L--V--T--L--M

-----------------------------------------------><---------------------------------------------------
--S--F--A--T--R--F--H--R--L--D--E--P--P--H--I--C--W--D--E--T--H--F--G--K--M--G--S--Y--Y--I--N--R--T-
GTCCTTCGCCACCCGCTTCCACCGCTTGGACGAGCCGCCGCACATCTGTTGGGATGAGACTCACTTTGGAAAAATGGGAAGTTACTATATCAACCGTACA
:::::::::::::::::::::.::..::::: ::::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::::.:: 
GTCCTTCGCCACCCGCTTCCATCGTCTGGACCAGCCGCCGCACATC---TGGGATGAGACTCACTTTGGAAAAATGGGAAGTTACTATATCAACCGCACC
--S--F--A--T--R--F--H--R--L--D--Q--P--P--H--I-----W--D--E--T--H--F--G--K--M--G--S--Y--Y--I--N--R--T-

--------------------------------><------------------------------------------------------------------
-F--F--F--D--V--H--P--P--L--G--K--M--L--I--G--L--A--G--Y--L--S--G--Y--D--G--T--F--L--F--Q--K--P--G--
TTTTTCTTTGATGTGCACCCGCCCCTGGGAAAGATGCTGATAGGTCTTGCTGGCTACCTGAGTGGATATGATGGTACCTTTTTGTTCCAGAAGCCTGGGG
::::::::::::::::::::.::.:::::::::                                                                   
TTTTTCTTTGATGTGCACCCACCTCTGGGAAAG-------------------------------------------------------------------
-F--F--F--D--V--H--P--P--L--G--K--------------------------------------------------------------------

-------------------------------------><-------------------------------------------------------------
D--K--Y--E--H--H--S--Y--M--G--M--R--G--F--C--A--F--L--G--S--W--L--V--P--F--A--Y--L--T--V--L--D--L--S
ATAAATATGAGCATCACAGCTACATGGGAATGAGAGGATTCTGTGCATTCCTTGGCTCCTGGCTGGTCCCCTTTGCCTACCTCACTGTACTGGATCTGTC
                                      ::::::::::::::.::::::. ::: .::::::::::::::::::::::.::::: :::::
--------------------------------------TTCTGTGCATTCCTCGGCTCCCTGCTCATCCCCTTTGCCTACCTCACTGTGCTGGAGCTGTC
---------------------------------------F--C--A--F--L--G--S--L--L--I--P--F--A--Y--L--T--V--L--E--L--S

----------------------------------------------><----------------------------------------------------
--K--S--L--S--A--A--L--L--T--A--A--L--L--T--F--D--T--G--C--L--T--L--S--Q--Y--I--L--L--D--P--I--L--M-
CAAGTCCCTCTCGGCAGCACTGCTCACAGCTGCCCTCCTCACCTTTGACACGGGATGCCTCACTCTGTCCCAGTACATCCTCCTTGACCCCATCCTGATG
: .:::::::.::::::::::::::.:.::::::::::::::::::   ::.::::::::::::::::::::::::::::::::::::::::::.:::::
CCGGTCCCTCCCGGCAGCACTGCTCGCGGCTGCCCTCCTCACCTTT---ACAGGATGCCTCACTCTGTCCCAGTACATCCTCCTTGACCCCATCTTGATG
--R--S--L--P--A--A--L--L--A--A--A--L--L--T--F-----T--G--C--L--T--L--S--Q--Y--I--L--L--D--P--I--L--M-

-------------------------------------------------------><-------------------------------------------
-F--F--I--M--A--A--M--L--S--M--V--K--Y--N--S--C--A--D--R--P--F--S--A--P--W--W--F--W--L--S--L--T--G--
TTCTTCATCATGGCTGCCATGCTGAGCATGGTCAAGTACAACTCTTGCGCCGACAGGCCCTTCTCTGCCCCCTGGTGGTTCTGGCTCAGCCTGACTGGCG
::::::::::::::::::::::::::::::::::::::::::::.::.:::      :::::::::::::::::::::::::::::::::::::::::::
TTCTTCATCATGGCTGCCATGCTGAGCATGGTCAAGTACAACTCCTGTGCC------CCCTTCTCTGCCCCCTGGTGGTTCTGGCTCAGCCTGACTGGCG
-F--F--I--M--A--A--M--L--S--M--V--K--Y--N--S--C--A--------P--F--S--A--P--W--W--F--W--L--S--L--T--G--

----------------------------------------------------------------------------------------------------
V--S--L--A--G--A--L--G--V--K--F--V--G--L--F--I--I--L--Q--V--G--L--N--T--I--A--D--L--W--Y--L--F--G--D
TTAGTCTTGCTGGTGCTTTAGGGGTCAAGTTTGTTGGCCTCTTTATCATCCTTCAAGTGGGGCTGAACACCATTGCAGACCTTTGGTACCTGTTCGGAGA
:::.::: :::::::::.:::::::::::::::::::::::::::::::::: :::::::::. ::::::: :: :::::::::::.:::::::.:::::
TTAATCTGGCTGGTGCTCTAGGGGTCAAGTTTGTTGGCCTCTTTATCATCCTGCAAGTGGGGTGGAACACCCTTTCAGACCTTTGGCACCTGTTTGGAGA
V--N--L--A--G--A--L--G--V--K--F--V--G--L--F--I--I--L--Q--V--G--W--N--T--L--S--D--L--W--H--L--F--G--D

---------------><-----------------------------------------------------------------------------------
--L--S--L--S--L--V--T--V--G--K--H--L--T--A--R--V--L--C--L--I--V--L--P--L--A--L--Y--T--A--T--F--A--V-
CCTCAGTCTTTCATTGGTGACTGTGGGAAAACACCTGACTGCTCGTGTCCTGTGCCTCATAGTGCTGCCCCTGGCTCTCTATACAGCCACCTTTGCTGTT
::::::: ::::: ::                                                                                    
CCTCAGTGTTTCAATG------------------------------------------------------------------------------------
--L--S--V--S--M-------------------------------------------------------------------------------------

----------------------><----------------------------------------------------------------------------
-H--F--M--V--L--S--K--S--G--P--G--D--G--F--F--S--S--A--F--Q--A--R--L--S--G--N--N--L--H--N--A--S--I--
CACTTCATGGTGCTGAGTAAAAGTGGCCCTGGTGACGGTTTCTTCAGTTCTGCCTTCCAGGCCCGGCTTTCAGGGAACAACCTGCACAATGCTTCCATCC
                        ::.:::::.::.::.:::::::::::::::::::::::::::::: ::::.:::: ::: ::::::::::::::::
------------------------GGTCCTGGCGATGGCTTCTTCAGTTCTGCCTTCCAGGCCCGGCTTGCAGGAAACACCCTTCACAATGCTTCCATCC
-------------------------G--P--G--D--G--F--F--S--S--A--F--Q--A--R--L--A--G--N--T--L--H--N--A--S--I--

-----><---------------------------------------------------------------------------------------------
P--E--H--L--A--Y--G--S--V--I--T--V--K--N--L--R--M--A--I--G--Y--L--H--S--H--R--H--L--Y--P--E--G--I--G
CTGAACACCTGGCCTACGGCTCTGTGATCACTGTGAAGAACCTCCGGATGGCCATCGGCTATCTGCACTCCCACAGGCACCTCTACCCCGAGGGCATTGG
:.:::                                                                                               
CCGAA-----------------------------------------------------------------------------------------------
P--E------------------------------------------------------------------------------------------------

---------------><-----------------------------------------------------------------><----------------
--A--R--Q--Q--Q--V--T--T--Y--L--H--K--D--Y--N--N--L--W--I--I--K--K--H--N--T--N--S--D--P--L--D--P--S-
TGCCCGTCAGCAGCAGGTCACCACCTATTTGCACAAGGACTACAACAACCTGTGGATTATCAAGAAACATAACACAAACTCAGATCCCCTAGACCCTTCC
                :::::::::::::::::::::::::::::::::::::::::.::::::::::::::.:::::::::   :::::::::::::: 
----------------GTCACCACCTATTTGCACAAGGACTACAACAACCTGTGGATCATCAAGAAACATAATACAAACTCA---CCCCTAGACCCTTCA
-----------------V--T--T--Y--L--H--K--D--Y--N--N--L--W--I--I--K--K--H--N--T--N--S-----P--L--D--P--S-

----------------------------------------------------><----------------------------------------------
-F--P--V--E--F--V--R--H--G--D--I--I--R--L--E--H--K--E--T--S--R--N--L--H--S--H--Y--H--E--A--P--M--T--
TTCCCAGTGGAGTTTGTAAGACATGGAGACATTATTCGACTAGAACACAAAGAAACTTCCCGGAACTTGCACAGTCACTATCATGAGGCCCCCATGACCC
.:::::::::::::.::::::::.::::::::.::::::::::::::::::   :::::.::::::.:::::::::::::::::::::::::: ::::::
CTCCCAGTGGAGTTCGTAAGACACGGAGACATCATTCGACTAGAACACAAA---ACTTCTCGGAACCTGCACAGTCACTATCATGAGGCCCCCCTGACCC
-L--P--V--E--F--V--R--H--G--D--I--I--R--L--E--H--K-----T--S--R--N--L--H--S--H--Y--H--E--A--P--L--T--

-------------------------------><-------------------------------------------------------------------
R--K--H--Y--Q--V--T--G--Y--G--I--N--G--T--G--D--S--N--D--F--W--R--I--E--V--V--N--R--K--F--G--N--R--I
GGAAGCACTATCAGGTCACCGGCTATGGCATAAATGGAACAGGGGACTCAAATGATTTCTGGCGGATTGAGGTCGTAAACAGGAAATTTGGAAACCGGAT
:::::::::::::::::::.:::::::::::::::::.::::::::::: :::::.:::::: ::::.::::::::::::::.:::::::::::::: ::
GGAAGCACTATCAGGTCACTGGCTATGGCATAAATGGGACAGGGGACTCCAATGACTTCTGGAGGATCGAGGTCGTAAACAGAAAATTTGGAAACCGCAT
R--K--H--Y--Q--V--T--G--Y--G--I--N--G--T--G--D--S--N--D--F--W--R--I--E--V--V--N--R--K--F--G--N--R--I

-----------------------------------------------------------------------------------><---------------
--K--V--L--R--S--R--I--R--F--I--H--L--V--T--G--C--V--L--G--S--S--G--K--V--L--P--K--W--G--W--E--Q--L-
CAAAGTGCTGAGAAGTCGAATTCGCTTCATCCATTTGGTCACAGGTTGTGTCCTGGGCTCCTCGGGAAAGGTTCTGCCCAAGTGGGGCTGGGAGCAGTTG
::::::::::::.::::::::::::.::::::::.:::::::::::::::::::::::::::::::.::.::.:::::::::   ::::::::::::.::
CAAAGTGCTGAGGAGTCGAATTCGCCTCATCCATCTGGTCACAGGTTGTGTCCTGGGCTCCTCGGGGAAAGTCCTGCCCAAG---GGCTGGGAGCAGCTG
--K--V--L--R--S--R--I--R--L--I--H--L--V--T--G--C--V--L--G--S--S--G--K--V--L--P--K-----G--W--E--Q--L-

---------------------------------------------------------------------------><-----------------------
-E--V--T--C--T--P--Y--L--K--E--T--L--N--S--I--W--N--V--E--D--H--I--N--P--K--L--P--N--I--S--L--D--V--
GAAGTTACTTGCACCCCATACCTGAAAGAAACCCTCAACTCCATCTGGAATGTGGAGGACCATATCAATCCCAAGTTGCCAAACATCAGCCTGGATGTGC
:::::.::.::::: ::::::::.::.::::::::::.::::.:::::::.:::::::::::::::::::::      :::::::::::::::::.::::
GAAGTCACCTGCACGCCATACCTAAAGGAAACCCTCAGCTCCGTCTGGAACGTGGAGGACCATATCAATCCC------CCAAACATCAGCCTGGACGTGC
-E--V--T--C--T--P--Y--L--K--E--T--L--S--S--V--W--N--V--E--D--H--I--N--P--------P--N--I--S--L--D--V--

----------------------------------------------------><----------------------------------------------
L--Q--P--S--F--P--E--I--L--L--E--S--H--M--V--M--I--R--G--N--S--G--L--K--P--K--D--N--E--F--T--S--K--P
TACAGCCCAGTTTTCCTGAGATCTTGCTGGAATCCCACATGGTCATGATCCGGGGGAACAGTGGCCTCAAACCCAAGGACAATGAGTTCACGTCCAAACC
:.::::::::::::::::::::  :::::::.::::::::::: :::::.::::::::::.:::::::::::::::.:: ::::::::::::::::::::
TGCAGCCCAGTTTTCCTGAGATAATGCTGGAGTCCCACATGGTGATGATTCGGGGGAACAATGGCCTCAAACCCAAAGAAAATGAGTTCACGTCCAAACC
L--Q--P--S--F--P--E--I--M--L--E--S--H--M--V--M--I--R--G--N--N--G--L--K--P--K--E--N--E--F--T--S--K--P

------------------------><----------------------------------------------------------><--------------
--W--H--W--P--I--N--Y--Q--G--L--R--F--S--G--V--N--D--T--D--F--R--V--Y--L--L--G--N--P--V--V--W--W--L-
CTGGCACTGGCCTATCAACTATCAGGGCCTACGCTTCTCAGGGGTCAATGACACAGATTTCCGAGTCTATCTGCTTGGCAACCCGGTGGTTTGGTGGCTG
::::::::::::.::::::::::::                                                            :::::::::::::::
CTGGCACTGGCCCATCAACTATCAG------------------------------------------------------------GTGGTTTGGTGGCTG
--W--H--W--P--I--N--Y--Q--------------------------------------------------------------V--V--W--W--L-

------------------------------------------------------------------------------------------><--------
-N--L--L--S--I--A--L--Y--L--L--S--G--S--I--I--A--V--A--M--Q--R--G--A--R--L--P--A--E--V--A--G--L--S--
AATCTGTTGAGCATCGCCCTCTACCTCCTCTCAGGGAGCATCATTGCTGTAGCCATGCAGAGAGGGGCACGGCTGCCAGCGGAGGTTGCAGGGTTGTCCC
::::::.:.::::::::::::::::::::::..:::::::::::::::::.::.::::::::::::::::.:::::: ::  ::         .::::::
AATCTGCTAAGCATCGCCCTCTACCTCCTCTTGGGGAGCATCATTGCTGTGGCTATGCAGAGAGGGGCACAGCTGCCTGCCCAG---------CTGTCCC
-N--L--L--S--I--A--L--Y--L--L--L--G--S--I--I--A--V--A--M--Q--R--G--A--Q--L--P--A--Q-----------L--S--

----------------------------------------------------------------------------------------------------
Q--V--L--L--R--G--G--G--Q--V--L--L--G--W--T--L--H--Y--F--P--F--F--L--M--G--R--V--L--Y--F--H--H--Y--F
AGGTCCTGCTTCGAGGAGGCGGCCAGGTCCTGCTCGGCTGGACACTCCATTACTTCCCGTTTTTCCTGATGGGCCGGGTCCTCTACTTCCACCACTACTT
:::::::::: ::::::::::: ::: :::::.:.:::::::.. ::::::::::::::::.:::::::::::::::.::::::::::::::::::::::
AGGTCCTGCTGCGAGGAGGCGGGCAGCTCCTGTTTGGCTGGATGATCCATTACTTCCCGTTCTTCCTGATGGGCCGGATCCTCTACTTCCACCACTACTT
Q--V--L--L--R--G--G--G--Q--L--L--F--G--W--M--I--H--Y--F--P--F--F--L--M--G--R--I--L--Y--F--H--H--Y--F

-------------------------------><-------------------------------------------------------------------
--P--A--M--L--F--S--S--M--L--T--G--I--L--W--D--T--L--L--R--L--C--A--W--G--L--A--S--W--P--L--A--R--G-
CCCAGCCATGCTCTTCTCAAGCATGTTGACAGGCATTCTGTGGGACACCCTCCTGCGGCTCTGTGCCTGGGGCTTGGCCTCATGGCCCCTGGCGAGGGGC
::: ::::::::::::::  :::::.:::::   .:.:::::::::::.:::::::::::::::::::::.::.:: :::: :   ::::::: :::: :
CCCCGCCATGCTCTTCTCCTGCATGCTGACA---GTCCTGTGGGACACTCTCCTGCGGCTCTGTGCCTGGAGCCTGTCCTCCTTTGCCCTGGCCAGGGCC
--P--A--M--L--F--S--C--M--L--T-----V--L--W--D--T--L--L--R--L--C--A--W--S--L--S--S--F--A--L--A--R--A-

----------------------------------------------><----------------------------------------------------
-I--H--V--A--G--I--L--S--L--L--L--G--T--A--Y--S--F--Y--L--F--H--P--L--A--Y--G--M--V--G--P--L--A--Q--
ATACATGTGGCGGGAATCCTGAGCCTGCTCCTGGGAACTGCCTACAGCTTCTACCTCTTCCACCCTCTGGCTTACGGGATGGTTGGTCCCCTGGCCCAGG
.::::::.: .::::::::::::::::::::::::::.::.::::                                             ::.::: :::
GTACATGCGCTGGGAATCCTGAGCCTGCTCCTGGGAATTGTCTAC---------------------------------------------CTAGCCGAGG
-V--H--A--L--G--I--L--S--L--L--L--G--I--V--Y-----------------------------------------------L--A--E--

---------------------------------------------------->
D--P--Q--S--P--M--A--G--L--R--W--L--D--S--W--D--F--*-
ACCCCCAAAGTCCAATGGCAGGACTAAGGTGGCTGGACTCATGGGACTTTTGA
::::::.::::::.::::::::::: ::::::::::: :::::::::::::::
ACCCCCGAAGTCCGATGGCAGGACTCAGGTGGCTGGAATCATGGGACTTTTGA
D--P--R--S--P--M--A--G--L--R--W--L--E--S--W--D--F--*-

Pig Consensus Sequence

>BGISUST0000897849
ATGCCACCGGCGGTGGGCGGAGGCCTGGCAGGGTCCGAGCTGCGTCCCCGGAGGGGCCGCTGTGGGTCCCAGGCTCCAAGGGCCGTGGGCGCGGATGCGG
CTGCCGAGACTACAGCGCGGAGCCCCAAACGGCCTGTTCCGGGCTCGCGGCGCTTCGAGGCGGTCGGCCAGTGGGCTCTACTGGCCCTGGTGACGCTAAT
GTCCTTCGCCACCCGCTTCCATCGTCTGGACCAGCCGCCGCACATC---TGGGATGAGACTCACTTTGGAAAAATGGGAAGTTACTATATCAACCGCACC
TTTTTCTTTGATGTGCACCCACCTCTGGGAAAG-------------------------------------------------------------------
--------------------------------------TTCTGTGCATTCCTCGGCTCCCTGCTCATCCCCTTTGCCTACCTCACTGTGCTGGAGCTGTC
CCGGTCCCTCCCGGCAGCACTGCTCGCGGCTGCCCTCCTCACCTTT---ACAGGATGCCTCACTCTGTCCCAGTACATCCTCCTTGACCCCATCTTGATG
TTCTTCATCATGGCTGCCATGCTGAGCATGGTCAAGTACAACTCCTGTGCC------CCCTTCTCTGCCCCCTGGTGGTTCTGGCTCAGCCTGACTGGCG
TTAATCTGGCTGGTGCTCTAGGGGTCAAGTTTGTTGGCCTCTTTATCATCCTGCAAGTGGGGTGGAACACCCTTTCAGACCTTTGGCACCTGTTTGGAGA
CCTCAGTGTTTCAATG------------------------------------------------------------------------------------
------------------------GGTCCTGGCGATGGCTTCTTCAGTTCTGCCTTCCAGGCCCGGCTTGCAGGAAACACCCTTCACAATGCTTCCATCC
CCGAA-----------------------------------------------------------------------------------------------
----------------GTCACCACCTATTTGCACAAGGACTACAACAACCTGTGGATCATCAAGAAACATAATACAAACTCA---CCCCTAGACCCTTCA
CTCCCAGTGGAGTTCGTAAGACACGGAGACATCATTCGACTAGAACACAAA---ACTTCTCGGAACCTGCACAGTCACTATCATGAGGCCCCCCTGACCC
GGAAGCACTATCAGGTCACTGGCTATGGCATAAATGGGACAGGGGACTCCAATGACTTCTGGAGGATCGAGGTCGTAAACAGAAAATTTGGAAACCGCAT
CAAAGTGCTGAGGAGTCGAATTCGCCTCATCCATCTGGTCACAGGTTGTGTCCTGGGCTCCTCGGGGAAAGTCCTGCCCAAG---GGCTGGGAGCAGCTG
GAAGTCACCTGCACGCCATACCTAAAGGAAACCCTCAGCTCCGTCTGGAACGTGGAGGACCATATCAATCCC------CCAAACATCAGCCTGGACGTGC
TGCAGCCCAGTTTTCCTGAGATAATGCTGGAGTCCCACATGGTGATGATTCGGGGGAACAATGGCCTCAAACCCAAAGAAAATGAGTTCACGTCCAAACC
CTGGCACTGGCCCATCAACTATCAG------------------------------------------------------------GTGGTTTGGTGGCTG
AATCTGCTAAGCATCGCCCTCTACCTCCTCTTGGGGAGCATCATTGCTGTGGCTATGCAGAGAGGGGCACAGCTGCCTGCCCAG---------CTGTCCC
AGGTCCTGCTGCGAGGAGGCGGGCAGCTCCTGTTTGGCTGGATGATCCATTACTTCCCGTTCTTCCTGATGGGCCGGATCCTCTACTTCCACCACTACTT
CCCCGCCATGCTCTTCTCCTGCATGCTGACA---GTCCTGTGGGACACTCTCCTGCGGCTCTGTGCCTGGAGCCTGTCCTCCTTTGCCCTGGCCAGGGCC
GTACATGCGCTGGGAATCCTGAGCCTGCTCCTGGGAATTGTCTAC---------------------------------------------CTAGCCGAGG
ACCCCCGAAGTCCGATGGCAGGACTCAGGTGGCTGGAATCATGGGACTTTTGA


>BGISUSP0000897849
MPPAVGGGLAGSELRPRRGRCGSQAPRAVGADAAAETTARSPKRPVPGSRRFEAVGQWALLALVTLMSFATRFHRLDQPPHI-WDETHFGKMGSYYINRT
FFFDVHPPLGK-----------------------------------FCAFLGSLLIPFAYLTVLELSRSLPAALLAAALLTF-TGCLTLSQYILLDPILM
FFIMAAMLSMVKYNSCA--PFSAPWWFWLSLTGVNLAGALGVKFVGLFIILQVGWNTLSDLWHLFGDLSVSM----------------------------
--------GPGDGFFSSAFQARLAGNTLHNASIPE-------------------------------------VTTYLHKDYNNLWIIKKHNTNS-PLDPS
LPVEFVRHGDIIRLEHK-TSRNLHSHYHEAPLTRKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRLIHLVTGCVLGSSGKVLPK-GWEQL
EVTCTPYLKETLSSVWNVEDHINP--PNISLDVLQPSFPEIMLESHMVMIRGNNGLKPKENEFTSKPWHWPINYQ--------------------VVWWL
NLLSIALYLLLGSIIAVAMQRGAQLPAQ---LSQVLLRGGGQLLFGWMIHYFPFFLMGRILYFHHYFPAMLFSCMLT-VLWDTLLRLCAWSLSSFALARA
VHALGILSLLLGIVY---------------LAEDPRSPMAGLRWLESWDF*