Sequences
EST Library Info
cki1Kidney - RNA from China
jej1Small intestine, jejunum
nco7Newborn 115 days, colon
Clusters
Oligos
SNPs

Gene ID ENSG00000015413 (click for geneview)
Transcript ID ENST00000261615(link to ensembl)
Symbol DPEP1
Localtion Chromosome:16:88214501:88232338:1 band: 16q24.3
Description Microsomal dipeptidase precursor (EC 3.4.13.19) (MDP) (Dehydropeptidase-I) (Renal dipeptidase) (RDP). [Source:Uniprot/SWISSPROT;Acc:P16444]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--W--S--G--W--W--L--W--P--L--V--A--V--C--T--A--D--F--F--R--D--E--A--E--R--I--M--R--D--S--P--V--I--
ATGTGGAGCGGATGGTGGCTGTGGCCCCTTGTGGCCGTCTGCACTGCAGACTTCTTTCGGGACGAGGCAGAGAGGATCATGAGGGACTCCCCTGTCATTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---><-----------------------------------------------------------------------------------------------
D--G--H--N--D--L--P--W--Q--L--L--D--M--F--N--N--R--L--Q--D--E--R--A--N--L--T--T--L--A--G--T--H--T--N
ATGGGCACAATGACCTCCCCTGGCAGCTGCTGGATATGTTCAACAACCGGCTGCAGGACGAGAGGGCCAACCTGACCACCTTGGCCGGCACACACACCAA
     ::::::::::: ::.::::::::::::.:: ::::::::::.:.::: ::::::  :.::::::::::  ::: :.::::: .:::.::::::::
-----CACAATGACCTGCCTTGGCAGCTGCTGAATCTGTTCAACAATCAGCTTCAGGACCCGGGGGCCAACCTCTCCAGCCTGGCCCACACGCACACCAA
------H--N--D--L--P--W--Q--L--L--N--L--F--N--N--Q--L--Q--D--P--G--A--N--L--S--S--L--A--H--T--H--T--N

------------------------------------><--------------------------------------------------------------
--I--P--K--L--R--A--G--F--V--G--G--Q--F--W--S-----V--Y--T--P--C--D--T--Q--N--K--D--A--V--R--R--T--L-
CATCCCCAAGCTGAGGGCCGGCTTTGTGGGAGGCCAGTTCTGGTCC---GTGTACACGCCCTGCGACACCCAGAACAAAGACGCCGTGCGGAGGACGCTG
::::::::::::::.:::.::::::::::: :::::::::::::::   :.::::..::::::::::::::::::::.:::::::::: .:::::: :::
CATCCCCAAGCTGAAGGCTGGCTTTGTGGGCGGCCAGTTCTGGTCCG--GCGTACGTGCCCTGCGACACCCAGAACAGAGACGCCGTGAAGAGGACCCTG
--I--P--K--L--K--A--G--F--V--G--G--Q--F--W--S--\--A--Y--V--P--C--D--T--Q--N--R--D--A--V--K--R--T--L-

------------------------------------------------------------------------><--------------------------
-E--Q--M--D--V--V--H--R--M--C--R--M--Y--P--E--T--F--L--Y--V--T--S--S--A--G--I--R--Q--A--F--R--E--G--
GAGCAGATGGACGTGGTCCACCGCATGTGCCGGATGTACCCGGAGACCTTCCTGTATGTCACCAGCAGTGCAGGCATTCGGCAGGCCTTCCGGGAAGGGA
:::::::: ::::: .:::: ::::::::::.:..:::.:: ::::::::: . :..:::::::::::.      ::.:::::::::::::::::.:: :
GAGCAGATCGACGTCATCCAGCGCATGTGCCAGGCGTATCCCGAGACCTTCGCCTGCGTCACCAGCAGC------ATCCGGCAGGCCTTCCGGGAGGGCA
-E--Q--I--D--V--I--Q--R--M--C--Q--A--Y--P--E--T--F--A--C--V--T--S--S--------I--R--Q--A--F--R--E--G--

----------------------------------------------------------------------------------------------------
K--V--A--S--L--I--G--V--E--G--G--H--S--I--D--S--S--L--G--V--L--R--A--L--Y--Q--L--G--M--R--Y--L--T--L
AGGTGGCCAGCCTGATCGGCGTGGAGGGCGGCCACTCCATTGACAGCAGTTTGGGCGTCCTGCGGGCACTCTATCAGCTGGGCATGCGGTACCTGACCCT
::::::::::::::.: :::::::::::.:::::::::::.::::::::..:::::::::::::::: :::::.:: ::::::::::::::: :::::::
AGGTGGCCAGCCTGGTGGGCGTGGAGGGTGGCCACTCCATCGACAGCAGCCTGGGCGTCCTGCGGGCCCTCTACCACCTGGGCATGCGGTACATGACCCT
K--V--A--S--L--V--G--V--E--G--G--H--S--I--D--S--S--L--G--V--L--R--A--L--Y--H--L--G--M--R--Y--M--T--L

-----------------------><--------------------------------------------------------------------><-----
--T--H--S--C--N--T--P--W--A--D--N--W--L--V--D--T--G--D--S--E--P--Q--S--Q--G--L--S--P--F--G--Q--R--V-
CACCCACAGCTGCAACACGCCCTGGGCTGACAACTGGCTGGTGGACACGGGAGACAGCGAGCCCCAGAGCCAAGGCTTGTCACCCTTTGGGCAGCGTGTG
::::::::::::::::::::::   ::.::::::::::::::::::::::: ::...:.:: ::::::::::::::.::::.: ::::::::::   :: 
CACCCACAGCTGCAACACGCCC---GCCGACAACTGGCTGGTGGACACGGGCGATGACAAGGCCCAGAGCCAAGGCCTGTCGCACTTTGGGCAG---GTC
--T--H--S--C--N--T--P-----A--D--N--W--L--V--D--T--G--D--D--K--A--Q--S--Q--G--L--S--H--F--G--Q-----V-

----------------------------------------------------------------------------------------------------
-V--K--E--L--N--R--L--G--V--L--I--D--L--A--H--V--S--V--A--T--M--K--A--T--L--Q--L--S--R--A--P--V--I--
GTGAAGGAGCTGAACCGTCTGGGGGTCCTCATCGACTTGGCTCACGTGTCTGTGGCCACCATGAAGGCCACCCTGCAGCTGTCCAGAGCCCCGGTCATCT
::::::::: ::::::: ::::: ::: : :::::::::::.::::::::.:::::::::::::.::::.:.::: :::::::: ..::::: :::::::
GTGAAGGAGATGAACCGGCTGGGCGTCATGATCGACTTGGCCCACGTGTCCGTGGCCACCATGAGGGCCGCTCTGAAGCTGTCCCAGGCCCCCGTCATCT
-V--K--E--M--N--R--L--G--V--M--I--D--L--A--H--V--S--V--A--T--M--R--A--A--L--K--L--S--Q--A--P--V--I--

----------------------------------------------------------------------><----------------------------
F--S--H--S--S--A--Y--S--V--C--A--S--R--R--N--V--P--D--D--V--L--R--L--V--K--Q--T--D--S--L--V--M--V--N
TCAGCCACTCCTCGGCCTACAGCGTGTGCGCAAGCCGGCGCAACGTGCCTGACGACGTCCTGAGGCTGGTGAAACAGACAGACAGCCTGGTGATGGTGAA
::::::::::::::::::::::. ::::: :. .::::::::::::::: ::.::::: ::  .:::::::                             
TCAGCCACTCCTCGGCCTACAGTCTGTGCCCGCACCGGCGCAACGTGCCGGATGACGTGCTCCAGCTGGTG-----------------------------
F--S--H--S--S--A--Y--S--L--C--P--H--R--R--N--V--P--D--D--V--L--Q--L--V------------------------------

-------------------------------------------------------><-------------------------------------------
--F--Y--N--N--Y--I--S--C--T--N--K--A--N--L--S--Q--V--A--D--H--L--D--H--I--K--E--V--A--G--A--R--A--V-
CTTCTACAACAATTACATTTCCTGCACCAACAAGGCCAACCTGTCCCAAGTGGCCGACCATCTGGATCACATCAAGGAGGTGGCAGGAGCCAGAGCCGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------><-------------------------------------------------------------------
-G--F--G--G--D--F--D--G--V--P--R--V--P--E--G--L--E--D--V--S--K--Y--P--D--L--I--A--E--L--L--R--R--N--
GGTTTTGGTGGGGACTTTGATGGTGTTCCAAGGGTCCCTGAGGGGCTGGAGGACGTCTCCAAGTATCCAGACCTGATCGCTGAGCTGCTCAGGAGGAACT
                                 :::::.  .:: ::::::::::: ::::::::.:::::::::.: ::.::::::::::::::: : :
---------------------------------GTCCCCTCAGGCCTGGAGGACGTGTCCAAGTACCCAGACCTGGTGGCCGAGCTGCTCAGGAGGCAGT
----------------------------------V--P--S--G--L--E--D--V--S--K--Y--P--D--L--V--A--E--L--L--R--R--Q--

-------------------------------------------------------------------><-------------------------------
W--T--E--A--E--V--K--G--A--L--A--D--N--L--L--R--V--F--E--A--V--E--Q--A--S--N--L--T--Q--A--P--E--E--E
GGACGGAGGCGGAGGTCAAGGGCGCACTGGCTGACAACCTGCTGAGGGTCTTCGAGGCTGTGGAACAGGCCAGCAACCTCACACAGGCTCCCGAGGAGGA
:::::::::: :::::::.:::::: :::::.:::::::::::::::::::::::::: :::::.:::                                
GGACGGAGGCCGAGGTCAGGGGCGCCCTGGCCGACAACCTGCTGAGGGTCTTCGAGGCAGTGGAGCAG--------------------------------
W--T--E--A--E--V--R--G--A--L--A--D--N--L--L--R--V--F--E--A--V--E--Q---------------------------------

----------------------------------------------------------------------------------------------------
--P--I--P--L--D--Q--L--G--G--S--C--R--T--H--Y--G--Y--S--S--G--A--S--S--L--H--R--H--W--G--L--L--L--A-
GCCCATCCCGCTGGACCAGCTGGGTGGCTCCTGCAGGACCCATTACGGCTACTCCTCTGGGGCTTCCAGCCTCCATCGCCACTGGGGGCTCCTGCTGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------->
-S--L--A--P--L--V--L--C--L--S--L--L--*-
TCCCTCGCTCCCCTGGTCCTCTGTCTGTCTCTCCTGTGA
                                       
---------------------------------------
---------------------------------------

Pig Consensus Sequence

>BGISUST0000880560
----------------------------------------------------------------------------------------------------
-----CACAATGACCTGCCTTGGCAGCTGCTGAATCTGTTCAACAATCAGCTTCAGGACCCGGGGGCCAACCTCTCCAGCCTGGCCCACACGCACACCAA
CATCCCCAAGCTGAAGGCTGGCTTTGTGGGCGGCCAGTTCTGGTCcgCGTACGTGCCCTGCGACACCCAGAACAGAGACGCCGTGAAGAGGACCCTGGAG
CAGATCGACGTCATCCAGCGCATGTGCCAGGCGTATCCCGAGACCTTCGCCTGCGTCACCAGCAGC------ATCCGGCAGGCCTTCCGGGAGGGCAAGG
TGGCCAGCCTGGTGGGCGTGGAGGGTGGCCACTCCATCGACAGCAGCCTGGGCGTCCTGCGGGCCCTCTACCACCTGGGCATGCGGTACATGACCCTCAC
CCACAGCTGCAACACGCCC---GCCGACAACTGGCTGGTGGACACGGGCGATGACAAGGCCCAGAGCCAAGGCCTGTCGCACTTTGGGCAG---GTCGTG
AAGGAGATGAACCGGCTGGGCGTCATGATCGACTTGGCCCACGTGTCCGTGGCCACCATGAGGGCCGCTCTGAAGCTGTCCCAGGCCCCCGTCATCTTCA
GCCACTCCTCGGCCTACAGTCTGTGCCCGCACCGGCGCAACGTGCCGGATGACGTGCTCCAGCTGGTG--------------------------------
----------------------------------------------------------------------------------------------------
------------------------------GTCCCCTCAGGCCTGGAGGACGTGTCCAAGTACCCAGACCTGGTGGCCGAGCTGCTCAGGAGGCAGTGGA
CGGAGGCCGAGGTCAGGGGCGCCCTGGCCGACAACCTGCTGAGGGTCTTCGAGGCAGTGGAGCAG-----------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------


>BGISUSP0000880560
-----------------------------------HNDLPWQLLNLFNNQLQDPGANLSSLAHTHTNIPKLKAGFVGGQFWSAYVPCDTQNRDAVKRTLE
QIDVIQRMCQAYPETFACVTSS--IRQAFREGKVASLVGVEGGHSIDSSLGVLRALYHLGMRYMTLTHSCNTP-ADNWLVDTGDDKAQSQGLSHFGQ-VV
KEMNRLGVMIDLAHVSVATMRAALKLSQAPVIFSHSSAYSLCPHRRNVPDDVLQLV--------------------------------------------
----------VPSGLEDVSKYPDLVAELLRRQWTEAEVRGALADNLLRVFEAVEQ---------------------------------------------
------------