Sequences
EST Library Info
jej1Small intestine, jejunum
pigcb1Unavailable
plac2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000072415 (click for geneview)
Transcript ID ENST00000261681(link to ensembl)
Symbol MPP5
Localtion Chromosome:14:66777774:66872288:1 band: 14q23.3
Description MAGUK p55 subfamily member 5. [Source:Uniprot/SWISSPROT;Acc:Q8N3R9]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--T--S--H--M--N--G--H--V--T--E--E--S--D--S--E--V--K--N--V--D--L--A--S--P--E--E--H--Q--K--H--R--
ATGACAACATCCCATATGAATGGGCATGTTACAGAGGAATCAGACAGCGAAGTAAAAAATGTTGATCTTGCATCACCAGAGGAACATCAGAAGCACCGAG
                                                                                 ::::::::::::::.::::
---------------------------------------------------------------------------------GAACATCAGAAGCATCGAG
----------------------------------------------------------------------------------E--H--Q--K--H--R--

----------------------------------------------------------------------------------------------------
E--M--A--V--D--C--P--G--D--L--G--T--R--M--M--P--I--R--R--S--A--Q--L--E--R--I--R--Q--Q--Q--E--D--M--R
AGATGGCTGTTGACTGCCCTGGAGATTTGGGCACCAGGATGATGCCAATACGTCGAAGTGCACAGTTGGAGCGTATTCGGCAACAACAGGAGGACATGAG
:::::::::::::::::::::::::::::::::::::::::::::::.::::::::::.:::::.:::::.:::::::::::::::::::::::::::::
AGATGGCTGTTGACTGCCCTGGAGATTTGGGCACCAGGATGATGCCAGTACGTCGAAGCGCACAATTGGAACGTATTCGGCAACAACAGGAGGACATGAG
E--M--A--V--D--C--P--G--D--L--G--T--R--M--M--P--V--R--R--S--A--Q--L--E--R--I--R--Q--Q--Q--E--D--M--R

----------------------------------------------------------------------------------------------------
--R--R--R--E--E--E--G--K--K--Q--E--L--D--L--N--S--S--M--R--L--K--K--L--A--Q--I--P--P--K--T--G--I--D-
GCGTAGGAGAGAGGAAGAAGGGAAAAAGCAAGAACTTGACCTTAATTCTTCCATGAGACTTAAGAAACTAGCCCAAATTCCTCCAAAGACCGGAATAGAT
::::::: :::::::::::::::::::.:::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::.::.:::::::::
GCGTAGGCGAGAGGAAGAAGGGAAAAAACAAGAACTTGACCTTAATTCTTCCATGAGACTAAAGAAACTAGCCCAAATTCCTCCAAAAACTGGAATAGAT
--R--R--R--E--E--E--G--K--K--Q--E--L--D--L--N--S--S--M--R--L--K--K--L--A--Q--I--P--P--K--T--G--I--D-

------------------------------------------------------------------><--------------------------------
-N--P--M--F--D--T--E--E--G--I--V--L--E--S--P--H--Y--A--V--K--I--L--E--I--E--D--L--F--S--S--L--K--H--
AACCCTATGTTTGATACAGAGGAAGGAATTGTCTTAGAAAGTCCTCATTATGCTGTGAAAATATTAGAAATAGAAGACTTGTTTTCTTCACTTAAACATA
:::::.::.:::::::::::.:::::::::::::::::::::::::::.::::::::::::::      .:.::::::::::::::::::::::::::.:
AACCCCATATTTGATACAGAAGAAGGAATTGTCTTAGAAAGTCCTCATCATGCTGTGAAAATA------GTGGAAGACTTGTTTTCTTCACTTAAACACA
-N--P--I--F--D--T--E--E--G--I--V--L--E--S--P--H--H--A--V--K--I--------V--E--D--L--F--S--S--L--K--H--

----------------------------------------------------------------------------------------------------
I--Q--H--T--L--V--D--S--Q--S--Q--E--D--I--S--L--L--L--Q--L--V--Q--N--K--D--F--Q--N--A--F--K--I--H--N
TCCAACATACTTTGGTAGATTCTCAGAGCCAGGAGGATATTTCACTGCTTTTACAACTTGTTCAAAATAAGGATTTCCAGAATGCATTTAAGATACACAA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::.::::::::::::::.::::::::::::::
TCCAACATACTTTGGTAGATTCTCAGAGCCAGGAGGATATTTCACTGCTTTTACAACTTGTACAAAATAAAGATTTCCAGAATGCGTTTAAGATACACAA
I--Q--H--T--L--V--D--S--Q--S--Q--E--D--I--S--L--L--L--Q--L--V--Q--N--K--D--F--Q--N--A--F--K--I--H--N

---------------------------------------------------------------------------><-----------------------
--A--I--T--V--H--M--N--K--A--S--P--P--F--P--L--I--S--N--A--Q--D--L--A--Q--E--V--Q--T--V--L--K--P--V-
TGCCATCACAGTACACATGAACAAGGCCAGTCCTCCATTTCCTCTTATCTCCAACGCACAAGATCTTGCTCAAGAGGTACAAACTGTTTTGAAGCCAGTT
.::..:::::::::::::::::::::::::::::::::::::::::::::::::.::.::::::::::: :::::::::::::::::::::::::::::.
CGCTGTCACAGTACACATGAACAAGGCCAGTCCTCCATTTCCTCTTATCTCCAATGCGCAAGATCTTGCACAAGAGGTACAAACTGTTTTGAAGCCAGTC
--A--V--T--V--H--M--N--K--A--S--P--P--F--P--L--I--S--N--A--Q--D--L--A--Q--E--V--Q--T--V--L--K--P--V-

-----------------------------------------------------><---------------------------------------------
-H--H--K--E--G--Q--E--L--T--A--L--L--N--T--P--H--I--Q--A--L--L--L--A--H--D--K--V--A--E--Q--E--M--Q--
CATCATAAGGAAGGACAAGAACTAACTGCTTTGCTGAATACTCCACATATTCAGGCACTTTTACTGGCCCACGATAAGGTTGCTGAGCAGGAAATGCAGC
::.:: :::::::::::::::.:::::::::::::::::.: ::.::::::::::::::::::::::::::.::::::::::::::::::::::::::::
CACCAGAAGGAAGGACAAGAATTAACTGCTTTGCTGAATGCACCGCATATTCAGGCACTTTTACTGGCCCATGATAAGGTTGCTGAGCAGGAAATGCAGC
-H--Q--K--E--G--Q--E--L--T--A--L--L--N--A--P--H--I--Q--A--L--L--L--A--H--D--K--V--A--E--Q--E--M--Q--

----------------------------------------------------------------------------------------------------
L--E--P--I--T--D--E--R--V--Y--E--S--I--G--Q--Y--G--G--E--T--V--K--I--V--R--I--E--K--A--R--D--I--P--L
TAGAGCCCATTACAGATGAGAGAGTTTATGAAAGTATTGGCCAGTATGGAGGAGAAACTGTAAAAATAGTTCGTATAGAAAAGGCTCGTGATATTCCGTT
:::::::::::.:::::::::::: :::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::
TAGAGCCCATTGCAGATGAGAGAGGTTATGAAAGCATTGGCCAGTATGGAGGAGAAACTGTAAAAATAGTTCGTATAGAAAAGGCTCGAGATATTCCGTT
L--E--P--I--A--D--E--R--G--Y--E--S--I--G--Q--Y--G--G--E--T--V--K--I--V--R--I--E--K--A--R--D--I--P--L

><--------------------------------------------------------------------------------------------------
--G--A--T--V--R--N--E--M--D--S--V--I--I--S--R--I--V--K--G--G--A--A--E--K--S--G--L--L--H--E--G--D--E-
GGGTGCTACAGTTCGTAATGAAATGGACTCTGTCATCATTAGCCGGATAGTAAAAGGGGGTGCTGCAGAGAAAAGTGGTCTGTTGCATGAAGGAGATGAA
:::::::::::::::::::::::::::.::::::::::::::.:::::::: :::::.::::::::::::::::::::.:::::::::::::::::::::
GGGTGCTACAGTTCGTAATGAAATGGATTCTGTCATCATTAGTCGGATAGTTAAAGGAGGTGCTGCAGAGAAAAGTGGCCTGTTGCATGAAGGAGATGAA
--G--A--T--V--R--N--E--M--D--S--V--I--I--S--R--I--V--K--G--G--A--A--E--K--S--G--L--L--H--E--G--D--E-

--------------------------------------------------------------><------------------------------------
-V--L--E--I--N--G--I--E--I--R--G--K--D--V--N--E--V--F--D--L--L--S--D--M--H--G--T--L--T--F--V--L--I--
GTTCTAGAGATTAATGGCATTGAAATTCGGGGGAAAGATGTCAATGAGGTTTTTGACTTGTTGTCTGATATGCATGGTACTTTGACTTTTGTCCTGATTC
::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::..::::::::::::::::::::::::: :::::.:::::::
GTTCTAGAGATTAATGGCATTGAAATTCGGGGGAAAGACGTCAATGAGGTTTTTGACTTACTGTCTGATATGCATGGTACTTTGACATTTGTTCTGATTC
-V--L--E--I--N--G--I--E--I--R--G--K--D--V--N--E--V--F--D--L--L--S--D--M--H--G--T--L--T--F--V--L--I--

----------------------------------------><----------------------------------------------------------
P--S--Q--Q--I--K--P--P--P--A--K--E--T--V--I--H--V--K--A--H--F--D--Y--D--P--S--D--D--P--Y--V--P--C--R
CCAGTCAACAGATCAAGCCGCCTCCTGCCAAGGAAACAGTAATCCATGTAAAAGCTCATTTTGACTATGACCCCTCAGATGACCCTTATGTTCCATGTCG
: ::::::::::::::::: :::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::: :::::
CAAGTCAACAGATCAAGCCTCCTCCTGCGAAGGAAACAGTAATCCATGTAAAAGCTCATTTTGACTATGACCCCTCAGATGACCCCTATGTTCCCTGTCG
P--S--Q--Q--I--K--P--P--P--A--K--E--T--V--I--H--V--K--A--H--F--D--Y--D--P--S--D--D--P--Y--V--P--C--R

----------------------------------------------------------------------------------------------------
--E--L--G--L--S--F--Q--K--G--D--I--L--H--V--I--S--Q--E--D--P--N--W--W--Q--A--Y--R--E--G--D--E--D--N-
AGAGTTAGGTCTGTCTTTTCAAAAAGGTGATATACTTCATGTGATCAGTCAAGAAGATCCAAACTGGTGGCAGGCCTACAGGGAAGGGGACGAAGATAAT
::::::::::::.:::::::::::.:: ::::: :::::::::::::::::.:::::::::::.::::::                              
AGAGTTAGGTCTATCTTTTCAAAAGGGGGATATCCTTCATGTGATCAGTCAGGAAGATCCAAATTGGTGG------------------------------
--E--L--G--L--S--F--Q--K--G--D--I--L--H--V--I--S--Q--E--D--P--N--W--W-------------------------------

------------------------><----------------------------------------------------------------------><--
-Q--P--L--A--G--L--V--P--G--K--S--F--Q--Q--Q--R--E--A--M--K--Q--T--I--E--E--D--K--E--P--E--K--S--G--
CAACCTCTAGCCGGGCTTGTTCCAGGGAAAAGCTTTCAGCAGCAAAGGGAAGCCATGAAACAAACCATAGAAGAAGATAAGGAGCCAGAAAAATCAGGAA
                           ::.:::::::::::::::::::::::::::::.:::::::::::.:::::::::::.::::::::::::   :
---------------------------AAGAGCTTTCAGCAGCAAAGGGAAGCCATGAAGCAAACCATAGAGGAAGATAAGGAACCAGAAAAATCA---A
----------------------------K--S--F--Q--Q--Q--R--E--A--M--K--Q--T--I--E--E--D--K--E--P--E--K--S-----

--------------------------------------------------------------------><------------------------------
K--L--W--C--A--K--K--N--K--K--K--R--K--K--V--L--Y--N--A--N--K--N--D--D--Y--D--N--E--E--I--L--T--Y--E
AACTGTGGTGTGCAAAGAAGAATAAAAAGAAGAGGAAAAAGGTTTTATATAATGCCAATAAAAATGATGATTATGACAACGAGGAGATCTTAACCTATGA
::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::   ::::::::.::.:::::::::::.:::::
AACTGTGGTGTGCAAAAAAGAATAAAAAGAAGAGGAAAAAGGTTTTATATAATGCCAATAAAAATGAT---TATGACAATGAAGAGATCTTAACTTATGA
K--L--W--C--A--K--K--N--K--K--K--R--K--K--V--L--Y--N--A--N--K--N--D-----Y--D--N--E--E--I--L--T--Y--E

----------------------------------------------------------------------------------------------------
--E--M--S--L--Y--H--Q--P--A-----N--R--K--R--P--I--I--L--I--G--P--Q--N--C--G--Q--N--E--L--R--Q--R--L-
GGAAATGTCACTTTATCATCAGCCAGCA---AATAGGAAGAGACCTATCATCTTGATTGGTCCACAGAACTGTGGCCAGAATGAATTGCGTCAGAGGCTC
.::.::::::::::::::::::::::::   ::::::::.:::::.:::::.::::::::::::::::::::::::::::::::::::::::::::::::
AGAGATGTCACTTTATCATCAGCCAGCAA--AATAGGAAAAGACCCATCATTTTGATTGGTCCACAGAACTGTGGCCAGAATGAATTGCGTCAGAGGCTC
--E--M--S--L--Y--H--Q--P--A--\--N--R--K--R--P--I--I--L--I--G--P--Q--N--C--G--Q--N--E--L--R--Q--R--L-

---------------------------------------><-----------------------------------------------------------
-M--N--K--E--K--D--R--F--A--S--A--V--P--H--T--T--R--S--R--R--D--Q--E--V--A--G--R--D--Y--H--F--V--S--
ATGAACAAAGAAAAGGACCGCTTTGCATCTGCAGTTCCTCATACAACCCGGAGTAGGCGAGACCAAGAAGTAGCCGGTAGAGATTACCACTTTGTTTCGC
::::::::::::::.::::::::::::::::::::::::   :::::::::::: : :::::::: :::::.:::::.::.:::::::::::.:::::.:
ATGAACAAAGAAAAAGACCGCTTTGCATCTGCAGTTCCT---ACAACCCGGAGTCGCCGAGACCATGAAGTGGCCGGCAGGGATTACCACTTCGTTTCAC
-M--N--K--E--K--D--R--F--A--S--A--V--P-----T--T--R--S--R--R--D--H--E--V--A--G--R--D--Y--H--F--V--S--

----------------------------------------------------------------------------------------------------
R--Q--A--F--E--A--D--I--A--A--G--K--F--I--E--H--G--E--F--E--K--N--L--Y--G--T--S--I--D--S--V--R--Q--V
GGCAAGCATTCGAGGCAGACATAGCAGCTGGAAAGTTCATTGAGCATGGTGAATTTGAGAAGAATTTGTATGGAACTAGCATAGATTCTGTACGGCAAGT
::::.:::::.::::::::::::::::::::::::::::::::::::::.:::::::::::.::::::::::::::.:::::::::::::::::::::::
GGCAGGCATTTGAGGCAGACATAGCAGCTGGAAAGTTCATTGAGCATGGCGAATTTGAGAAAAATTTGTATGGAACCAGCATAGATTCTGTACGGCAAGT
R--Q--A--F--E--A--D--I--A--A--G--K--F--I--E--H--G--E--F--E--K--N--L--Y--G--T--S--I--D--S--V--R--Q--V

------------------------------------------><--------------------------------------------------------
--I--N--S--G--K--I--C--L--L--S--L--R--T--Q--S--L--K--T--L--R--N--S--D--L--K--P--Y--I--I--F--I--A--P-
GATCAACTCTGGCAAAATATGTCTTTTAAGTCTTCGTACACAGTCATTGAAGACTCTCCGGAATTCAGATTTGAAACCATATATTATCTTCATTGCACCC
::::::::: ::::::::::::::::::::::::::::::::::: ::::::::::: :::::.:::::.::::::::::::::::::::::::::::::
GATCAACTCGGGCAAAATATGTCTTTTAAGTCTTCGTACACAGTCCTTGAAGACTCTACGGAACTCAGACTTGAAACCATATATTATCTTCATTGCACCC
--I--N--S--G--K--I--C--L--L--S--L--R--T--Q--S--L--K--T--L--R--N--S--D--L--K--P--Y--I--I--F--I--A--P-

-----------------------------------------------------><---------------------------------------------
-P--S--Q--E--R--L--R--A--L--L--A--K--E--G--K--N--P--K--P--E--E--L--R--E--I--I--E--K--T--R--E--M--E--
CCTTCACAAGAAAGACTTCGGGCATTATTGGCCAAAGAAGGCAAGAATCCAAAGCCTGAAGAGTTGAGAGAAATCATTGAGAAGACAAGAGAGATGGAGC
::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::::
CCTTCACAAGAAAGACTTCGGGCATTATTGGCCAAAGAGGGCAAGAATCCAAAGCCTGAAGAGTTGAGAGAAATCATTGAGAAGACTAGAGAGATGGAGC
-P--S--Q--E--R--L--R--A--L--L--A--K--E--G--K--N--P--K--P--E--E--L--R--E--I--I--E--K--T--R--E--M--E--

----------------------------------------------------------------------------------------------------
Q--N--N--G--H--Y--F--D--T--A--I--V--N--S--D--L--D--K--A--Y--Q--E--L--L--R--L--I--N--K--L--D--T--E--P
AGAACAATGGCCACTACTTTGATACGGCAATTGTGAATTCCGATCTTGATAAAGCCTATCAGGAATTGCTTAGGTTAATTAACAAACTTGATACTGAACC
:::::::.::::::::::::::.::::::::::::::.:: :::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::
AGAACAACGGCCACTACTTTGACACGGCAATTGTGAACTCAGATCTTGATAAAGCCTATCAGGAATTGCTTAGGTTGATTAACAAACTTGATACTGAACC
Q--N--N--G--H--Y--F--D--T--A--I--V--N--S--D--L--D--K--A--Y--Q--E--L--L--R--L--I--N--K--L--D--T--E--P

------------------------------>
--Q--W--V--P--S--T--W--L--R--*-
TCAGTGGGTACCATCCACTTGGCTGAGGTGA
:::::::::::::::::::::::::::::::
TCAGTGGGTACCATCCACTTGGCTGAGGTGA
--Q--W--V--P--S--T--W--L--R--*-

Pig Consensus Sequence

>BGISUST0000890894
---------------------------------------------------------------------------------GAACATCAGAAGCATCGAG
AGATGGCTGTTGACTGCCCTGGAGATTTGGGCACCAGGATGATGCCAGTACGTCGAAGCGCACAATTGGAACGTATTCGGCAACAACAGGAGGACATGAG
GCGTAGGCGAGAGGAAGAAGGGAAAAAACAAGAACTTGACCTTAATTCTTCCATGAGACTAAAGAAACTAGCCCAAATTCCTCCAAAAACTGGAATAGAT
AACCCCATATTTGATACAGAAGAAGGAATTGTCTTAGAAAGTCCTCATCATGCTGTGAAAATA------GTGGAAGACTTGTTTTCTTCACTTAAACACA
TCCAACATACTTTGGTAGATTCTCAGAGCCAGGAGGATATTTCACTGCTTTTACAACTTGTACAAAATAAAGATTTCCAGAATGCGTTTAAGATACACAA
CGCTGTCACAGTACACATGAACAAGGCCAGTCCTCCATTTCCTCTTATCTCCAATGCGCAAGATCTTGCACAAGAGGTACAAACTGTTTTGAAGCCAGTC
CACCAGAAGGAAGGACAAGAATTAACTGCTTTGCTGAATGCACCGCATATTCAGGCACTTTTACTGGCCCATGATAAGGTTGCTGAGCAGGAAATGCAGC
TAGAGCCCATTGCAGATGAGAGAGGTTATGAAAGCATTGGCCAGTATGGAGGAGAAACTGTAAAAATAGTTCGTATAGAAAAGGCTCGAGATATTCCGTT
GGGTGCTACAGTTCGTAATGAAATGGATTCTGTCATCATTAGTCGGATAGTTAAAGGAGGTGCTGCAGAGAAAAGTGGCCTGTTGCATGAAGGAGATGAA
GTTCTAGAGATTAATGGCATTGAAATTCGGGGGAAAGACGTCAATGAGGTTTTTGACTTACTGTCTGATATGCATGGTACTTTGACATTTGTTCTGATTC
CAAGTCAACAGATCAAGCCTCCTCCTGCGAAGGAAACAGTAATCCATGTAAAAGCTCATTTTGACTATGACCCCTCAGATGACCCCTATGTTCCCTGTCG
AGAGTTAGGTCTATCTTTTCAAAAGGGGGATATCCTTCATGTGATCAGTCAGGAAGATCCAAATTGGTGG------------------------------
---------------------------AAGAGCTTTCAGCAGCAAAGGGAAGCCATGAAGCAAACCATAGAGGAAGATAAGGAACCAGAAAAATCA---A
AACTGTGGTGTGCAAAAAAGAATAAAAAGAAGAGGAAAAAGGTTTTATATAATGCCAATAAAAATGAT---TATGACAATGAAGAGATCTTAACTTATGA
AGAGATGTCACTTTATCATCAGCCAGCaaATAGGAAAAGACCCATCATTTTGATTGGTCCACAGAACTGTGGCCAGAATGAATTGCGTCAGAGGCTCATG
AACAAAGAAAAAGACCGCTTTGCATCTGCAGTTCCT---ACAACCCGGAGTCGCCGAGACCATGAAGTGGCCGGCAGGGATTACCACTTCGTTTCACGGC
AGGCATTTGAGGCAGACATAGCAGCTGGAAAGTTCATTGAGCATGGCGAATTTGAGAAAAATTTGTATGGAACCAGCATAGATTCTGTACGGCAAGTGAT
CAACTCGGGCAAAATATGTCTTTTAAGTCTTCGTACACAGTCCTTGAAGACTCTACGGAACTCAGACTTGAAACCATATATTATCTTCATTGCACCCCCT
TCACAAGAAAGACTTCGGGCATTATTGGCCAAAGAGGGCAAGAATCCAAAGCCTGAAGAGTTGAGAGAAATCATTGAGAAGACTAGAGAGATGGAGCAGA
ACAACGGCCACTACTTTGACACGGCAATTGTGAACTCAGATCTTGATAAAGCCTATCAGGAATTGCTTAGGTTGATTAACAAACTTGATACTGAACCTCA
GTGGGTACCATCCACTTGGCTGAGGTGA


>BGISUSP0000890894
---------------------------EHQKHREMAVDCPGDLGTRMMPVRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGID
NPIFDTEEGIVLESPHHAVKI--VEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAVTVHMNKASPPFPLISNAQDLAQEVQTVLKPV
HQKEGQELTALLNAPHIQALLLAHDKVAEQEMQLEPIADERGYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWW----------
---------KSFQQQREAMKQTIEEDKEPEKS-KLWCAKKNKKKRKKVLYNANKND-YDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLM
NKEKDRFASAVP-TTRSRRDHEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR*