Sequences
EST Library Info
cte1Testicle - RNA from China
ecc1Foetus 50 days, cortex cerebri
eye1Foetus 50 days, Eye
hea2Heart
jca1Joint capsule
pliv1Unavailable
spl1Spleen
vin1M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000069956 (click for geneview)
Transcript ID ENST00000261845(link to ensembl)
Symbol MAPK6
Localtion Chromosome:15:50098739:50145753:1 band: 15q21.2
Description Mitogen-activated protein kinase 6 (EC 2.7.1.37) (Extracellular signal-regulated kinase 3) (ERK-3) (MAP kinase isoform p97) (p97- MAPK). [Source:Uniprot/SWISSPROT;Acc:Q16659]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--E--K--F--E--S--L--M--N--I--H--G--F--D--L--G--S--R--Y--M--D--L--K--P--L--G--C--G--G--N--G--L--
ATGGCAGAGAAATTTGAAAGTCTCATGAACATTCATGGTTTTGATCTGGGTTCTAGGTATATGGACTTAAAACCATTGGGTTGTGGAGGCAATGGCTTGG
               :::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::
---------------GAAAGTCTCATGAACATTCATGGTTTTGATCTGGGCTCTAGGTATATGGACTTAAAACCATTGGGTTGTGGAGGCAATGGCTTGG
----------------E--S--L--M--N--I--H--G--F--D--L--G--S--R--Y--M--D--L--K--P--L--G--C--G--G--N--G--L--

----------------------------------------------------------------------------------------------------
V--F--S--A--V--D--N--D--C--D--K--R--V--A--I--K--K--I--V--L--T--D--P--Q--S--V--K--H--A--L--R--E--I--K
TTTTTTCTGCTGTAGACAATGACTGTGACAAAAGAGTAGCCATCAAGAAAATTGTCCTTACTGATCCCCAGAGTGTCAAACATGCTCTACGTGAAATCAA
:::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::.::
TTTTTTCTGCTGTAGACAATGACTGTGACAAAAGAGTAGCCATCAAGAAAATAGTCCTTACTGATCCCCAGAGTGTCAAACATGCTCTACGTGAAATTAA
V--F--S--A--V--D--N--D--C--D--K--R--V--A--I--K--K--I--V--L--T--D--P--Q--S--V--K--H--A--L--R--E--I--K

----------------------------------------------------------------------------------------------------
--I--I--R--R--L--D--H--D--N--I--V--K--V--F--E--I--L--G--P--S--G--S--Q--L--T--D--D--V--G--S--L--T--E-
AATTATTAGAAGACTTGACCATGATAACATTGTGAAAGTGTTTGAGATTCTTGGTCCCAGTGGAAGCCAATTAACAGACGATGTGGGCTCTCTTACGGAA
::::::::::::::::::::::::::::::::::::.::::::::.:::::::::::.:::::::::::.::::::::.::::::::::::::::: :::
AATTATTAGAAGACTTGACCATGATAACATTGTGAAGGTGTTTGAAATTCTTGGTCCTAGTGGAAGCCAGTTAACAGATGATGTGGGCTCTCTTACCGAA
--I--I--R--R--L--D--H--D--N--I--V--K--V--F--E--I--L--G--P--S--G--S--Q--L--T--D--D--V--G--S--L--T--E-

----------------------------------------------------------------------------------------------------
-L--N--S--V--Y--I--V--Q--E--Y--M--E--T--D--L--A--N--V--L--E--Q--G--P--L--L--E--E--H--A--R--L--F--M--
CTGAACAGTGTTTACATTGTTCAGGAGTACATGGAGACAGACTTGGCTAATGTGCTGGAGCAGGGCCCTTTACTGGAAGAGCATGCCAGGCTTTTCATGT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::
CTGAACAGTGTTTACATTGTTCAGGAGTACATGGAGACAGACTTGGCTAATGTGCTGGAACAGGGCCCTTTACTGGAAGAGCATGCCAGGCTTTTCATGT
-L--N--S--V--Y--I--V--Q--E--Y--M--E--T--D--L--A--N--V--L--E--Q--G--P--L--L--E--E--H--A--R--L--F--M--

----------------------------------------------------------------------------------------------------
Y--Q--L--L--R--G--L--K--Y--I--H--S--A--N--V--L--H--R--D--L--K--P--A--N--L--F--I--N--T--E--D--L--V--L
ATCAGCTGCTACGGGGGCTCAAGTATATTCACTCTGCAAATGTACTGCACAGAGATCTCAAACCAGCTAATCTTTTCATTAATACGGAAGACTTGGTGCT
::::::::::::: ::::::::.::::::::::: :::::.:::::::::::::::::::::::::::::::::::::::::.:: ::::::::::::::
ATCAGCTGCTACGTGGGCTCAAATATATTCACTCAGCAAACGTACTGCACAGAGATCTCAAACCAGCTAATCTTTTCATTAACACTGAAGACTTGGTGCT
Y--Q--L--L--R--G--L--K--Y--I--H--S--A--N--V--L--H--R--D--L--K--P--A--N--L--F--I--N--T--E--D--L--V--L

------------------------------------------------------><--------------------------------------------
--K--I--G--D--F--G--L--A--R--I--M--D--P--H--Y--S--H--K--G--H--L--S--E--G--L--V--T--K--W--Y--R--S--P-
GAAGATAGGTGACTTTGGTCTTGCACGGATCATGGATCCTCATTATTCCCATAAGGGTCATCTTTCTGAAGGATTGGTTACTAAATGGTACAGATCTCCA
:::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.:.::::::::::::::::::::::::::::
GAAGATAGGTGACTTTGGTCTTGCACGGATCATGGATCCCCATTATTCCCATAAGGGTCATCTTTCTGAGGAATTGGTTACTAAATGGTACAGATCTCCA
--K--I--G--D--F--G--L--A--R--I--M--D--P--H--Y--S--H--K--G--H--L--S--E--E--L--V--T--K--W--Y--R--S--P-

--------------------------------------------------------------------------------------------------->
-R--L--L--L--S--P--N--N--Y--T--K--A--I--D--M--W--A--A--G--C--I--F--A--E--M--L--T--G--K--T--L--F--A--
CGTCTTTTACTTTCTCCTAATAATTATACTAAAGCCATTGACATGTGGGCTGCAGGCTGCATCTTTGCTGAAATGCTGACTGGTAAAACCCTTTTTGCAG
:::::::::::::::::::::::: ::::::::::::::::::::.::::::::::.::::::::::::::::::::::::::::::::.::.:::::: 
CGTCTTTTACTTTCTCCTAATAATAATACTAAAGCCATTGACATGCGGGCTGCAGGTTGCATCTTTGCTGAAATGCTGACTGGTAAAACTCTCTTTGCA-
-R--L--L--L--S--P--N--N--N--T--K--A--I--D--M--R--A--A--G--C--I--F--A--E--M--L--T--G--K--T--L--F--A--

<---------------------------------------------------------------------------------------------------
G--A--H--E--L--E--Q--M--Q--L--I--L--E--S--I--P--V--V--H--E--E--D--R--Q--E--L--L--S--V--I--P--V--Y--I
GTGCACATGAACTTGAACAGATGCAGCTGATTTTAGAATCTATTCCTGTTGTACATGAGGAAGATCGTCAGGAGCTTCTCAGCGTAATTCCAGTTTACAT
  :::::::::::::::::::::: :::::::::::::::: ::::::::::.:::::::::::::::::::::::::::::.:::::::::::::::::
--GCACATGAACTTGAACAGATGCTGCTGATTTTAGAATCTTTTCCTGTTGTGCATGAGGAAGATCGTCAGGAGCTTCTCAGTGTAATTCCAGTTTACAT
---A--H--E--L--E--Q--M--L--L--I--L--E--S--F--P--V--V--H--E--E--D--R--Q--E--L--L--S--V--I--P--V--Y--I

----------------------------------------------------------------><----------------------------------
--R--N--D--M--T--E--P--H--K--P--L--T--Q--L--L--P--G--I--S--R--E--A--L--D--F--L--E--Q--I--L--T--F--S-
TAGAAATGACATGACTGAGCCACACAAACCTTTAACTCAGCTGCTTCCAGGAATTAGTCGAGAAGCACTGGATTTCCTGGAACAAATTTTGACATTTAGC
.::::::::. ::::::::::::::::::::::::::::::::::::::::::::::::.::::   :::::::::::::::::::::::::::::::::
CAGAAATGATCTGACTGAGCCACACAAACCTTTAACTCAGCTGCTTCCAGGAATTAGTCAAGAA---CTGGATTTCCTGGAACAAATTTTGACATTTAGC
--R--N--D--L--T--E--P--H--K--P--L--T--Q--L--L--P--G--I--S--Q--E-----L--D--F--L--E--Q--I--L--T--F--S-

----------------------------------------------------------------------------------------------------
-P--M--D--R--L--T--A--E--E--A--L--S--H--P--Y--M--S--I--Y--S--F--P--M--D--E--P--I--S--S--H--P--F--H--
CCCATGGATCGGTTAACAGCAGAAGAAGCACTCTCCCATCCTTACATGAGCATATATTCTTTTCCAATGGATGAGCCAATTTCAAGCCATCCTTTTCATA
::::: ::::::::.:: ::::::::::::::.:::::::::::::::::::: ::::::::::::::::::.:::: ::::::: .:::::::::::::
CCCATTGATCGGTTGAC-GCAGAAGAAGCACTTTCCCATCCTTACATGAGCATTTATTCTTTTCCAATGGATAAGCCTATTTCAATTCATCCTTTTCATA
-P--I--D--R--L--T--A--E--E--A--L--S--H--P--Y--M--S--I--Y--S--F--P--M--D--K--P--I--S--I--H--P--F--H--

---------------------------------------------------------------------><-----------------------------
I--E--D--E--V--D--D--I--L--L--M--D--E--T--H--S--H--I--Y--N--W--E--R--Y--H--D--C--Q--F--S--E--H--D--W
TTGAAGATGAAGTTGATGATATTTTGCTTATGGATGAAACTCACAGTCACATTTATAACTGGGAAAGGTATCATGATTGTCAGTTTTCAGAGCATGATTG
::::::::      ::::::.:::::::::::::::::::::: :::::::::::::::::::::   ::.:::::::::::.:::::::::::::: ::
TTGAAGAT------GATGATGTTTTGCTTATGGATGAAACTCAGAGTCACATTTATAACTGGGAA---TACCATGATTGTCAATTTTCAGAGCATGAATG
I--E--D--------D--D--V--L--L--M--D--E--T--Q--S--H--I--Y--N--W--E-----Y--H--D--C--Q--F--S--E--H--E--W

----------------------------------------------------------------------------------------------------
--P--V--H--N--N--F--D--I--D--E--V--Q--L--D--P--R--A--L--S--D--V--T--D--E--E--E--V--Q--V--D--P--R--K-
GCCTGTACATAACAACTTTGATATTGATGAAGTTCAGCTTGATCCAAGAGCTCTGTCCGATGTCACTGATGAAGAAGAAGTACAAGTTGATCCCCGAAAA
::::.::::::::::::::::::.::::::::::.: :::::.::::::::::::::.:::::::::::::::::.:::::::::::..::::..:::::
GCCTATACATAACAACTTTGATACTGATGAAGTTTATCTTGACCCAAGAGCTCTGTCTGATGTCACTGATGAAGAGGAAGTACAAGTCAATCCTTGAAAA
--P--I--H--N--N--F--D--T--D--E--V--Y--L--D--P--R--A--L--S--D--V--T--D--E--E--E--V--Q--V--N--P--*--K-

----------------------------------------------------------------------------------------------------
-Y--L--D--G--D--R--E--K--Y--L--E--D--P--A--F--D--T--N--Y--S--T--E--P--C--W--Q--Y--S--D--H--H--E--N--
TATTTGGATGGAGATCGGGAAAAGTATCTGGAGGATCCTGCTTTTGATACCAATTACTCTACTGAGCCTTGTTGGCAATACTCAGATCATCATGAAAACA
::::::::::::::::: :::::::::.:::::::::.::::::::::::::::::::. :::::::::::::::::::::.:::::::.::::::::::
TATTTGGATGGAGATCGTGAAAAGTATTTGGAGGATCTTGCTTTTGATACCAATTACTTGACTGAGCCTTGTTGGCAATACCCAGATCACCATGAAAACA
-Y--L--D--G--D--R--E--K--Y--L--E--D--L--A--F--D--T--N--Y--L--T--E--P--C--W--Q--Y--P--D--H--H--E--N--

----------------------------------------------------------------------------------------------------
K--Y--C--D--L--E--C--S--H--T--C--N--Y--K--T--R--S--S--S--Y--L--D--N--L--V--W--R--E--S--E--V--N--H--Y
AATATTGTGATCTGGAGTGTAGCCATACTTGTAACTACAAAACGAGGTCATCATCATATTTAGATAACTTAGTTTGGAGAGAGAGTGAAGTTAACCATTA
::.:::::::::::::::::::::::::::::::::::::::: ::::::::::: ::::::::::::::::::::::::::::::::::::::.:::::
AACATTGTGATCTGGAGTGTAGCCATACTTGTAACTACAAAACCAGGTCATCATCCTATTTAGATAACTTAGTTTGGAGAGAGAGTGAAGTTAATCATTA
K--H--C--D--L--E--C--S--H--T--C--N--Y--K--T--R--S--S--S--Y--L--D--N--L--V--W--R--E--S--E--V--N--H--Y

----------------------------------------------------------------------------------------------------
--Y--E--P--K--L--I--I--D--L--S--N--W--K--E--Q--S--K--E--K--S--D--K--K--G--K--S--K--C--E--R--N--G--L-
CTATGAACCCAAGCTTATTATAGATCTTTCCAATTGGAAAGAACAAAGCAAAGAAAAATCTGATAAGAAAGGCAAATCAAAATGTGAAAGGAATGGATTG
:.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::.::::::::::
CCATGAACCCAAGCTTATTATAGATCTTTCCAATTGGAAAGAACAAAGCAAAGAAAAATCTGATAAGAAAGGCAAGTCAAAATGTGAAAAGAATGGATTG
--H--E--P--K--L--I--I--D--L--S--N--W--K--E--Q--S--K--E--K--S--D--K--K--G--K--S--K--C--E--K--N--G--L-

----------------------------------------------------------------------------------------------------
-V--K--A--Q--I--A--L--E--E--A--S--Q--Q--L--A--G--K--E--R--E--K--N--Q--G--F--D--F--D--S--F--I--A--G--
GTTAAAGCCCAGATAGCGCTAGAGGAAGCATCACAGCAACTGGCTGGAAAAGAAAGGGAAAAGAATCAGGGATTTGATTTTGATTCCTTTATTGCAGGAA
::::::::::::::::: ::::::::::::::::::::..::::::.::::::::::::::::::::::::::::::.::::::::::::::::::::::
GTTAAAGCCCAGATAGCCCTAGAGGAAGCATCACAGCAGTTGGCTGAAAAAGAAAGGGAAAAGAATCAGGGATTTGACTTTGATTCCTTTATTGCAGGAA
-V--K--A--Q--I--A--L--E--E--A--S--Q--Q--L--A--E--K--E--R--E--K--N--Q--G--F--D--F--D--S--F--I--A--G--

----------------------------------------------------------------------------------------------------
T--I--Q--L--S--S--Q--H--E--P--T--D--V--V--D--K--L--N--D--L--N--S--S--V--S--Q--L--E--L--K--S--L--I--S
CTATTCAGCTTAGTTCCCAGCATGAGCCTACTGATGTTGTTGATAAATTAAATGACTTGAATAGCTCAGTGTCCCAACTAGAATTGAAAAGTTTGATATC
:::::::.:::::::: ::.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CTATTCAACTTAGTTCACAACATGAGCCTACTGATGTTGTTGACAAATTAAATGACTTGAATAGCTCAGTGTCCCAACTAGAATTGAAAAGTTTGATATC
T--I--Q--L--S--S--Q--H--E--P--T--D--V--V--D--K--L--N--D--L--N--S--S--V--S--Q--L--E--L--K--S--L--I--S

----------------------------------------------------------------------------------------------------
--K--S--V--S--Q--E--K--Q--E--K--G--M--A--N--L--A--Q--L--E--A--L--Y--Q--S--S--W--D--S--Q--F--V--S--G-
AAAGTCAGTAAGCCAAGAAAAACAGGAAAAAGGAATGGCAAATCTGGCTCAATTAGAAGCCTTGTACCAGTCTTCTTGGGACAGCCAGTTTGTGAGTGGT
.:::::::::::::.:::::::::::::::::::: :::::::.:.:::::.:::::::::::::::::::::::::::::.::::::::::::.:::::
GAAGTCAGTAAGCCGAGAAAAACAGGAAAAAGGAAAGGCAAATTTAGCTCAGTTAGAAGCCTTGTACCAGTCTTCTTGGGATAGCCAGTTTGTGGGTGGT
--K--S--V--S--R--E--K--Q--E--K--G--K--A--N--L--A--Q--L--E--A--L--Y--Q--S--S--W--D--S--Q--F--V--G--G-

----------------------------------------------------------------------------------------------------
-G--E--D--C--F--F--I--N--Q--F--C-----E--V--R--K--D--E--Q--V--E--K--E--N--T--Y--T--S--Y--L--D--K--F--
GGGGAGGACTGTTTTTTCATAAATCAGTTTTGT---GAGGTAAGGAAGGATGAACAAGTTGAGAAGGAAAACACTTACACTAGTTACTTGGACAAGTTCT
::.::::::::::::.:::::::::::::::::   :::::::::::::::::.:: .::::.::::::::.: ::::::.::::::.::::::::::::
GGAGAGGACTGTTTTCTCATAAATCAGTTTTGTTGTGAGGTAAGGAAGGATGAGCATATTGAAAAGGAAAATAATTACACCAGTTACCTGGACAAGTTCT
-G--E--D--C--F--L--I--N--Q--F--C--C--E--V--R--K--D--E--H--I--E--K--E--N--N--Y--T--S--Y--L--D--K--F--

----------------------------------------------------------------------------------------------------
F--S--R--K--E--D--T--E--M--L--E--T--E--P--V--E--D--G--K--L--G--E--R--G--H--E--E--G--F--L--N--N--S--G
TTAGCAGGAAAGAAGATACTGAAATGCTAGAAACTGAGCCAGTAGAGGATGGGAAGCTTGGGGAGAGAGGACATGAGGAAGGATTTCTGAACAACAGTGG
::::::::::.:::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::.: :::::::::::::::::::.::::::::
TTAGCAGGAAGGAAGATACTGAAATGCTAGAAACTGAGCCGGTAGAAGATGGGAAGCTTGGGGAGAGAGAAAATGAGGAAGGATTTCTGAATAACAGTGG
F--S--R--K--E--D--T--E--M--L--E--T--E--P--V--E--D--G--K--L--G--E--R--E--N--E--E--G--F--L--N--N--S--G

----------------------------------------------------------------------------------------------------
--E--F--L--F--N--K--Q--L--E--S--I--G--I--P--Q--F--H--S--P--V--G--S--P--L--K--S--I--Q--A--T--L--T--P-
GGAGTTCCTCTTTAACAAGCAGCTCGAGTCCATAGGCATCCCACAGTTTCACAGTCCAGTTGGGTCACCACTTAAGTCAATACAGGCCACATTAACACCT
::::::::::::::::::::::::.::.::::::::::::::.::::::::::::::::::::::::::.::::::::::::::::::::::::::::::
GGAGTTCCTCTTTAACAAGCAGCTTGAATCCATAGGCATCCCGCAGTTTCACAGTCCAGTTGGGTCACCGCTTAAGTCAATACAGGCCACATTAACACCT
--E--F--L--F--N--K--Q--L--E--S--I--G--I--P--Q--F--H--S--P--V--G--S--P--L--K--S--I--Q--A--T--L--T--P-

---------------------------------------------------------------------
-S--A--M--K--S--S--P--Q--I--P--H--Q--T--Y--S--S--I--L--K--H--L--N--*-
TCTGCTATGAAATCTTCCCCTCAAATTCCTCATCAAACATACAGCAGCATTCTGAAACATCTGAACTAA
:::::::::::::::::::::::.::::::::: :::::::::::::::::::::::::::::::::::
TCTGCTATGAAATCTTCCCCTCAGATTCCTCATAAAACATACAGCAGCATTCTGAAACATCTGAACTAA
-S--A--M--K--S--S--P--Q--I--P--H--K--T--Y--S--S--I--L--K--H--L--N--*-

Pig Consensus Sequence

>BGISUST0000892763
---------------GAAAGTCTCATGAACATTCATGGTTTTGATCTGGGCTCTAGGTATATGGACTTAAAACCATTGGGTTGTGGAGGCAATGGCTTGG
TTTTTTCTGCTGTAGACAATGACTGTGACAAAAGAGTAGCCATCAAGAAAATAGTCCTTACTGATCCCCAGAGTGTCAAACATGCTCTACGTGAAATTAA
AATTATTAGAAGACTTGACCATGATAACATTGTGAAGGTGTTTGAAATTCTTGGTCCTAGTGGAAGCCAGTTAACAGATGATGTGGGCTCTCTTACCGAA
CTGAACAGTGTTTACATTGTTCAGGAGTACATGGAGACAGACTTGGCTAATGTGCTGGAACAGGGCCCTTTACTGGAAGAGCATGCCAGGCTTTTCATGT
ATCAGCTGCTACGTGGGCTCAAATATATTCACTCAGCAAACGTACTGCACAGAGATCTCAAACCAGCTAATCTTTTCATTAACACTGAAGACTTGGTGCT
GAAGATAGGTGACTTTGGTCTTGCACGGATCATGGATCCCCATTATTCCCATAAGGGTCATCTTTCTGAGGAATTGGTTACTAAATGGTACAGATCTCCA
CGTCTTTTACTTTCTCCTAATAATAATACTAAAGCCATTGACATGCGGGCTGCAGGTTGCATCTTTGCTGAAATGCTGACTGGTAAAACTCTCTTTGCA-
--GCACATGAACTTGAACAGATGCTGCTGATTTTAGAATCTTTTCCTGTTGTGCATGAGGAAGATCGTCAGGAGCTTCTCAGTGTAATTCCAGTTTACAT
CAGAAATGATCTGACTGAGCCACACAAACCTTTAACTCAGCTGCTTCCAGGAATTAGTCAAGAA---CTGGATTTCCTGGAACAAATTTTGACATTTAGC
CCCATTGATCGGTTggCAGAAGAAGCACTTTCCCATCCTTACATGAGCATTTATTCTTTTCCAATGGATAAGCCTATTTCAATTCATCCTTTTCATATTG
AAGATGATGATGTTTTGCTTATGGATGAAACTCAGAGTCACATTTATAACTGGGAA---TACCATGATTGTCAATTTTCAGAGCATGAATGGCCTATACA
TAACAACTTTGATACTGATGAAGTTTATCTTGACCCAAGAGCTCTGTCTGATGTCACTGATGAAGAGGAAGTACAAGTCAATCCTTGAAAATATTTGGAT
GGAGATCGTGAAAAGTATTTGGAGGATCTTGCTTTTGATACCAATTACTTGACTGAGCCTTGTTGGCAATACCCAGATCACCATGAAAACAAACATTGTG
ATCTGGAGTGTAGCCATACTTGTAACTACAAAACCAGGTCATCATCCTATTTAGATAACTTAGTTTGGAGAGAGAGTGAAGTTAATCATTACCATGAACC
CAAGCTTATTATAGATCTTTCCAATTGGAAAGAACAAAGCAAAGAAAAATCTGATAAGAAAGGCAAGTCAAAATGTGAAAAGAATGGATTGGTTAAAGCC
CAGATAGCCCTAGAGGAAGCATCACAGCAGTTGGCTGAAAAAGAAAGGGAAAAGAATCAGGGATTTGACTTTGATTCCTTTATTGCAGGAACTATTCAAC
TTAGTTCACAACATGAGCCTACTGATGTTGTTGACAAATTAAATGACTTGAATAGCTCAGTGTCCCAACTAGAATTGAAAAGTTTGATATCGAAGTCAGT
AAGCCGAGAAAAACAGGAAAAAGGAAAGGCAAATTTAGCTCAGTTAGAAGCCTTGTACCAGTCTTCTTGGGATAGCCAGTTTGTGGGTGGTGGAGAGGAC
TGTTTTCTCATAAATCAGTTTTGTTGTGAGGTAAGGAAGGATGAGCATATTGAAAAGGAAAATAATTACACCAGTTACCTGGACAAGTTCTTTAGCAGGA
AGGAAGATACTGAAATGCTAGAAACTGAGCCGGTAGAAGATGGGAAGCTTGGGGAGAGAGAAAATGAGGAAGGATTTCTGAATAACAGTGGGGAGTTCCT
CTTTAACAAGCAGCTTGAATCCATAGGCATCCCGCAGTTTCACAGTCCAGTTGGGTCACCGCTTAAGTCAATACAGGCCACATTAACACCTTCTGCTATG
AAATCTTCCCCTCAGATTCCTCATAAAACATACAGCAGCATTCTGAAACATCTGAAC


>BGISUSP0000892763
-----ESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVKHALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTE
LNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDPHYSHKGHLSEELVTKWYRSP
RLLLSPNNNTKAIDMRAAGCIFAEMLTGKTLFA-AHELEQMLLILESFPVVHEEDRQELLSVIPVYIRNDLTEPHKPLTQLLPGISQE-LDFLEQILTFS
PIDRLAEEALSHPYMSIYSFPMDKPISIHPFHIEDDDVLLMDETQSHIYNWE-YHDCQFSEHEWPIHNNFDTDEVYLDPRALSDVTDEEEVQVNP*KYLD
GDREKYLEDLAFDTNYLTEPCWQYPDHHENKHCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYHEPKLIIDLSNWKEQSKEKSDKKGKSKCEKNGLVKA
QIALEEASQQLAEKEREKNQGFDFDSFIAGTIQLSSQHEPTDVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGKANLAQLEALYQSSWDSQFVGGGED
CFLINQFCCEVRKDEHIEKENNYTSYLDKFFSRKEDTEMLETEPVEDGKLGERENEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAM
KSSPQIPHKTYSSILKHLN