Sequences
EST Library Info
lin5Large intestine
mga5Mammary gland - 7 days after weaning
mgp4Mammary gland - 7 days pre birth
pliv7Unavailable
rec4Rectum
tra1Trachea
uio6Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000138600 (click for geneview)
Transcript ID ENST00000261854(link to ensembl)
Symbol PSL2_HUMAN
Localtion Chromosome:15:48787057:48845191:-1 band: 15q21.2
Description Signal peptide peptidase-like 2A (EC 3.4.99.-) (SPP-like 2A protein) (SPPL2a protein) (Intramembrane protease 3) (IMP3) (Presenilin-like protein 2).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------------------><---------------------------------
-M--G--P--Q--R--R--L--S--P--A--G--A--A--L--L--W--G--F--L--L--Q--L--T--A--A--Q--E--A--I--L--H--A--S--
ATGGGGCCGCAGCGGCGGCTGTCCCCTGCCGGGGCCGCCCTACTCTGGGGCTTCCTGCTCCAGCTGACAGCCGCTCAGGAAGCAATCTTGCATGCGTCTG
                                                                  :::::.:::::::::::::::.:::::::.::..
------------------------------------------------------------------ACAGCTGCTCAGGAAGCAATCCTGCATGCATCCA
-------------------------------------------------------------------T--A--A--Q--E--A--I--L--H--A--S--

-------------------------------------------------------------------------------------><-------------
G--N--G--T-----------T--K--D--Y--C--M--L--Y--N--P--Y--W--T--A--L--P--S--T--L--E--N--A--T--S--I--S--L
GAAATGGCACA---------ACCAAGGACTACTGCATGCTTTATAACCCTTATTGGACAGCTCTTCCAAGTACCCTAGAAAATGCAACTTCCATTAGTTT
::::.::: ..          : ::::::::::::::::: :::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::
GAAACGGCCTGCCTTCACCATCAAAGGACTACTGCATGCTGTATAACCCTCATTGGACAGCTCTTCCAAGTACCCTAGAAAATGCAACTTCCATTAGTTT
R--N--G--L--P--S--P--S--K--D--Y--C--M--L--Y--N--P--H--W--T--A--L--P--S--T--L--E--N--A--T--S--I--S--L

----------------------------------------------------------------------------------------------------
--M--N--L--T--S--T--P--L--C--N--L--S--D--I--P--P--V--G--I--K--S--K--A--V--V--V--P--W--G--S--C--H--F-
GATGAATCTGACTTCCACACCACTATGCAACCTTTCTGATATTCCTCCTGTTGGCATAAAGAGCAAAGCAGTTGTGGTTCCATGGGGAAGCTGCCATTTT
:::::::.::::: ::::::::::.::::.::::::::::::::::::::  :: :::::::.::::::::::::::: : .::::::: :::::: :::
GATGAATTTGACTACCACACCACTGTGCAGCCTTTCTGATATTCCTCCTGAAGGAATAAAGAACAAAGCAGTTGTGGTACAGTGGGGAACCTGCCAATTT
--M--N--L--T--T--T--P--L--C--S--L--S--D--I--P--P--E--G--I--K--N--K--A--V--V--V--Q--W--G--T--C--Q--F-

--------------------------------------------------------------------><------------------------------
-L--E--K--A--R--I--A--Q--K--G--G--A--E--A--M--L--V--V--N--N--S--V--L--F--P--P--S--G--N--R--S--E--F--
CTTGAAAAAGCCAGAATTGCACAGAAAGGAGGTGCTGAAGCAATGTTAGTTGTCAATAACAGTGTCCTATTTCCTCCCTCAGGTAACAGATCTGAATTTC
:::::::::::::::::::::::.: :::::::::::::::: ::::.::::.::::::::::::::::                               
CTTGAAAAAGCCAGAATTGCACAAACAGGAGGTGCTGAAGCATTGTTGGTTGCCAATAACAGTGTCCTA-------------------------------
-L--E--K--A--R--I--A--Q--T--G--G--A--E--A--L--L--V--A--N--N--S--V--L--------------------------------

----------------------------------------------------------><----------------------------------------
P--D--V--K--I--L--I--A--F--I--S--Y--K--D--F--R--D--M--N--Q--T--L--G--D--N--I--T--V--K--M--Y--S--P--S
CTGATGTGAAAATACTGATTGCATTTATAAGCTACAAAGACTTTAGAGATATGAACCAGACTCTAGGAGATAACATTACTGTGAAAATGTATTCTCCATC
                                                           ::::: :::::::::::::::::::::::::::::::::::
-----------------------------------------------------------ACTCTCGGAGATAACATTACTGTGAAAATGTATTCTCCATC
------------------------------------------------------------T--L--G--D--N--I--T--V--K--M--Y--S--P--S

--------------------------------------------------------------------------------------------><------
--W--P--N--F--D--Y--T--M--V--V--I--F--V--I--A--V--F--T--V--A--L--G--G--Y--W--S--G--L--V--E--L--E--N-
GTGGCCTAACTTTGATTATACTATGGTGGTTATTTTTGTAATTGCGGTGTTCACTGTGGCATTAGGTGGATACTGGAGTGGACTAGTTGAATTGGAAAAC
:::::::::::::::.::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::.::.:::.:::::   ::::::
GTGGCCTAACTTTGACTATACTATGGTGGTTATTTTTGTAATTGCTGTGTTCACTGTGGCATTAGGTGGATACTGGAGCGGGCTAATTGAA---GAAAAC
--W--P--N--F--D--Y--T--M--V--V--I--F--V--I--A--V--F--T--V--A--L--G--G--Y--W--S--G--L--I--E-----E--N-

----------------------------------------------------------------------------------------------------
-L--K--A--V--T-----T--E--D--R--E--M--R--K--K--K--E--E--Y--L--T--F--S--P--L--T--V--V--I--F--V--V--I--
TTGAAAGCAGTGACA---ACTGAAGATAGAGAAATGAGGAAAAAGAAGGAAGAATATTTAACTTTTAGTCCTCTTACAGTTGTAATATTTGTGGTCATCT
 ::::.:::::::::    :::::::::::::::::::::::::::::::::::::::: ::::::::::::.: ::::::::::::::::: :::::::
ATGAAGGCAGTGACAAACTCTGAAGATAGAGAAATGAGGAAAAAGAAGGAAGAATATTTTACTTTTAGTCCTTTAACAGTTGTAATATTTGTTGTCATCT
-M--K--A--V--T--N--S--E--D--R--E--M--R--K--K--K--E--E--Y--F--T--F--S--P--L--T--V--V--I--F--V--V--I--

--------------------------------------------><------------------------------------------------------
C--C--V--M--M--V--L--L--Y--F--F--Y--K--W--L--V--Y--V--M--I--A--I--F--C--I--A--S--A--M--S--L--Y--N--C
GCTGTGTTATGATGGTCTTACTTTATTTCTTCTACAAATGGTTGGTTTATGTTATGATAGCAATTTTCTGCATAGCATCAGCAATGAGTCTGTACAACTG
::::.:::::::::::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::.:::::::::::::::::
GCTGCGTTATGATGGTCTTACTTTATTTCTTCTACAAATGGTTG---TATGTTATGATAGCAATTTTCTGCATAGCATCAGCGATGAGTCTGTACAACTG
C--C--V--M--M--V--L--L--Y--F--F--Y--K--W--L-----Y--V--M--I--A--I--F--C--I--A--S--A--M--S--L--Y--N--C

-----------------------------------------><---------------------------------------------------------
--L--A--A--L--I--H--K--I--P--Y--G--Q--C--T--I--A--C--R--G--K--N--M--E--V--R--L--I--F--L--S--G--L--C-
TCTTGCTGCACTAATTCATAAGATACCATATGGACAATGCACGATTGCATGTCGTGGCAAAAACATGGAAGTGAGACTTATTTTTCTCTCTGGACTGTGC
:::::::::::::::::.::::::: :::.::::::::::   ::::..:::::::::::::.::: :::::::::::::::::::::::::::::::::
TCTTGCTGCACTAATTCGTAAGATAGCATGTGGACAATGC---ATTGTGTGTCGTGGCAAAAGCATTGAAGTGAGACTTATTTTTCTCTCTGGACTGTGC
--L--A--A--L--I--R--K--I--A--C--G--Q--C-----I--V--C--R--G--K--S--I--E--V--R--L--I--F--L--S--G--L--C-

-------------------------------------------><-------------------------------------------------------
-I--A--V--A--V--V--W--A--V--F--R--N--E--D--R--W--A--W--I--L--Q--D--I--L--G--I--A--F--C--L--N--L--I--
ATAGCAGTAGCTGTTGTTTGGGCTGTGTTTCGAAATGAAGACAGGTGGGCTTGGATTTTACAGGATATCTTGGGGATTGCTTTCTGTCTGAATTTAATTA
::::::.::::::::::::::::.::.::::::::::::      :::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATAGCAATAGCTGTTGTTTGGGCCGTATTTCGAAATGAA------TGGGCTTGGATTTTACAGGATATCTTGGGGATTGCTTTCTGTCTGAATTTAATTA
-I--A--I--A--V--V--W--A--V--F--R--N--E--------W--A--W--I--L--Q--D--I--L--G--I--A--F--C--L--N--L--I--

-------------------------><-------------------------------------------------------------------------
K--T--L--K--L--P--N--F--K--S--C--V--I--L--L--G--L--L--L--L--Y--D--V--F--F--V--F--I--T--P--F--I--T--K
AAACACTGAAGTTGCCCAACTTCAAGTCATGTGTGATACTTCTAGGCCTTCTCCTCCTCTATGATGTATTTTTTGTTTTCATAACACCATTCATCACAAA
:::::.:::::::.:::::.::::::::::::::::::::::::::.:::::.::::::::::::::::::::.::::::::::::::::::::::::::
AAACATTGAAGTTACCCAATTTCAAGTCATGTGTGATACTTCTAGGTCTTCTTCTCCTCTATGATGTATTTTTCGTTTTCATAACACCATTCATCACAAA
K--T--L--K--L--P--N--F--K--S--C--V--I--L--L--G--L--L--L--L--Y--D--V--F--F--V--F--I--T--P--F--I--T--K

><-------------------------------------------------------><-----------------------------------------
--N--G--E--S--I--M--V--E--L--A--A--G--P--F--G--N--N--E--K--L--P--V--V--I--R--V--P--K--L--I--Y--F--S-
GAATGGTGAGAGTATCATGGTTGAACTCGCAGCTGGACCTTTTGGAAATAATGAAAAGTTGCCAGTAGTCATCAGAGTACCAAAACTGATCTATTTCTCA
:   ::.::::::::::::::::::::.::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.::...::::::::::
G---GGCGAGAGTATCATGGTTGAACTTGCAGCTGGACCTTTTGGAAATAATGAAAAGTTACCAGTAGTCATCAGAGTACCAAAGCTAGCCTATTTCTCA
-----G--E--S--I--M--V--E--L--A--A--G--P--F--G--N--N--E--K--L--P--V--V--I--R--V--P--K--L--A--Y--F--S-

------------------------------------------------------------><--------------------------------------
-V--M--S--V--C--L--M--P--V--S--I--L--G--F--G--D--I--I--V--P--G--L--L--I--A--Y--C--R--R--F--D--V--Q--
GTAATGAGTGTGTGCCTCATGCCTGTTTCAATATTGGGTTTTGGAGACATTATTGTACCAGGCCTGTTGATTGCATACTGTAGAAGATTTGATGTTCAGA
::::::::.::::::::.::::: ::::::::::::::::::::::::::::::::::::   ::.::::::::::::::::::::::::::::::::::
GTAATGAGCGTGTGCCTTATGCCAGTTTCAATATTGGGTTTTGGAGACATTATTGTACCA---CTATTGATTGCATACTGTAGAAGATTTGATGTTCAGA
-V--M--S--V--C--L--M--P--V--S--I--L--G--F--G--D--I--I--V--P-----L--L--I--A--Y--C--R--R--F--D--V--Q--

--------------------------------------><------------------------------------------------------------
T--G--S--S--Y--I--Y--Y--V--S--S--T--V--A--Y--A--I--G--M--I--L--T--F--V--V--L--V--L--M--K--K--G--Q--P
CTGGTTCTTCTTACATATACTATGTTTCGTCTACAGTTGCCTATGCTATTGGCATGATACTTACATTTGTTGTTCTGGTGCTGATGAAAAAGGGGCAACC
:::::::::::   :::::::::::::: ::.:::.::   ::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::
CTGGTTCTTCT---ATATACTATGTTTCCTCCACAATT---TATGCTGTTGGCATGATACTTACATTTGTTGTTCTGGTGCTGATGAAAAAGGGGCAACC
T--G--S--S-----I--Y--Y--V--S--S--T--I-----Y--A--V--G--M--I--L--T--F--V--V--L--V--L--M--K--K--G--Q--P

--------------------------------------------------------------------------------------------------->
--A--L--L--Y--L--V--P--C--T--L--I--T--A--S--V--V--A--W--R--R--K--E--M--K--K--F--W--K--G--N--S--Y--Q-
TGCTCTCCTCTATTTAGTACCTTGCACACTTATTACTGCCTCAGTTGTTGCCTGGAGACGTAAGGAAATGAAAAAGTTCTGGAAAGGTAACAGCTATCAG
:::::::::::::::::::::.:::::::: ::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::.:.::::: ::
TGCTCTCCTCTATTTAGTACCCTGCACACTAATTACTGCCTCAGTTGTTGCTTGGAGACGTAAGGAAATGAAAAAGTTCTGGAAAGGTAGCGGCTATGAG
--A--L--L--Y--L--V--P--C--T--L--I--T--A--S--V--V--A--W--R--R--K--E--M--K--K--F--W--K--G--S--G--Y--E-

<------------------------------------------------------------------------->
-M--M--D--H--L--D--C--A--T--N--E--E--N--P--V--I--S--G--E--Q--I--V--Q--Q--*-
ATGATGGACCATTTGGATTGTGCAACAAATGAAGAAAACCCTGTGATATCTGGTGAACAGATTGTCCAGCAATAA
::::::::::::.::::.:.::::::::::::::::::::::::::.  :::::::::::::::::         
ATGATGGACCATCTGGACTATGCAACAAATGAAGAAAACCCTGTGACTGCTGGTGAACAGATTGTC---------
-M--M--D--H--L--D--Y--A--T--N--E--E--N--P--V--T--A--G--E--Q--I--V----------

Pig Consensus Sequence

>BGISUST0000889859
------------------------------------------------------------------ACAGCTGCTCAGGAAGCAATCCTGCATGCATCCA
GAAACGGCCTGCCTTCACCATCAAAGGACTACTGCATGCTGTATAACCCTCATTGGACAGCTCTTCCAAGTACCCTAACTTCCATTAGTTTGATGAATTT
GACTACCACACCACTGTGCAGCCTTTCTGATATTCCTCCTGAAGGAATAAAGAACAAAGCAGTTGTGGTACAGTGGGGAACCTGCCAATTTCTTGAAAAA
GCCAGAATTGCACAAACAGGAGGTGCTGAAGCATTGTTGGTTGCCAATAACAGTGTCCTA----------------------------------------
--------------------------------------------------ACTCTCGGAGATAACATTACTGTGAAAATGTATTCTCCATCGTGGCCTAA
CTTTGACTATACTATGGTGGTTATTTTTGTAATTGCTGTGTTCACTGTGGCATTAGGTGGATACTGGAGCGGGCTAATTGAA---GAAAACATGAAGGCA
GTGACAAACTCTGAAGATAGAGAAATGAGGAAAAAGAAGGAAGAATATTTTACTTTTAGTCCTTTAACAGTTGTAATATTTGTTGTCATCTGCTGCGTTA
TGATGGTCTTACTTTATTTCTTCTACAAATGG---TATGTTATGATAGCAATTTTCTGCATAGCATCAGCGATGAGTCTGTACAACTGTCTTGCTGCACT
AATTCGTAAGATAGCATGTGGACAATGC---ATTGTGTGTCGTGGCAAAAGCATTGAAGTGAGACTTATTTTTCTCTCTGGACTGTGCATAGCAATAGCT
GTTGTTTGGGCCGTATTTCGAAATGAA------TGGGCTTGGATTTTACAGGATATCTTGGGGATTGCTTTCTGTCTGAATTTAATTAAAACATTGAAGT
TACCCAATTTCAAGTCATGTGTGATACTTCTAGGTCTTCTTCTCCTCTATGATGTATTTTTCGTTTTCATAACACCATTCATCACAAAG---GGCGAGAG
TATCATGGTTGAACTTGCAGCTGGACCTTTTGGAAATAATGAAAAGTTACCAGTAGTCATCAGAGTACCAAAGCTAGCCTATTTCTCAGTAATGAGCGTG
TGCCTTATGCCAGTTTCAATATTGGGTTTTGGAGACATTATTGTACCA---CTATTGATTGCATACTGTAGAAGATTTGATGTTCAGACTGGTTCTTCTA
TATACTATGTTTCCTCCACAATT---TATGCTGTTGGCATGATACTTACATTTGTTGTTCTGGTGCTGATGAAAAAGGGGCAACCTGCTCTCCTCTATTT
AGTACCCTGCACACTAATTACTGCCTCAGTTGTTGCTTGGAGACGTAAGGAAATGAAAAAGTTCTGGAAAGGTAGCGGCTATGAGATGATGGACCATCTG
GACTATGCAACAAATGAAGAAAACCCTGTGACTGCTGGTGAACAGATTGTC---------


>BGISUSP0000889859
----------------------TAAQEAILHASRNGLPSPSKDYCMLYNPHWTALPSTLTSISLMNLTTTPLCSLSDIPPEGIKNKAVVVQWGTCQFLEK
ARIAQTGGAEALLVANNSVL------------------------------TLGDNITVKMYSPSWPNFDYTMVVIFVIAVFTVALGGYWSGLIE-ENMKA
VTNSEDREMRKKKEEYFTFSPLTVVIFVVICCVMMVLLYFFYKW-YVMIAIFCIASAMSLYNCLAALIRKIACGQC-IVCRGKSIEVRLIFLSGLCIAIA
VVWAVFRNE--WAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLYDVFFVFITPFITK-GESIMVELAAGPFGNNEKLPVVIRVPKLAYFSVMSV
CLMPVSILGFGDIIVP-LLIAYCRRFDVQTGSSIYYVSSTI-YAVGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGSGYEMMDHL
DYATNEENPVTAGEQIV---